Protein detail
NID2
Nidogen-2 (NID-2) (Osteonidogen)
Entry name NID2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Nidogen-2 (NID-2) (Osteonidogen)
Protein Class (3)
Plasma proteinsPredicted intracellular proteinsPredicted secreted proteins
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
Nidogen 2
Chromosome
14
Position
52004809-52069059
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization5
Tissue SpecificbrainCell SpecificAdrenal medulla cellsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway8
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Cellular Component (6)
Molecular Function (4)
Biological Process (3)
Canonical Pathways
M276 Pid fgf pathway
Mediation Categories
Adhesion and uptake mediation
Relations & Evidence36
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | Cellinker | Yes | No | Yes | No | No |
| glycoprotein | ecm | Matrisome | Yes | No | Yes | No | No |
| basement_membrane | ecm | Matrisome | Yes | No | Yes | No | No |
| ligand | ligand | talklr | Yes | No | Yes | No | No |
| ligand | ligand | connectomeDB2020 | Yes | No | Yes | No | No |
| ligand | ligand | iTALK | Yes | No | Yes | No | No |
| ligand | ligand | EMBRACE | Yes | No | Yes | No | No |
| ligand | ligand | CellTalkDB | Yes | No | Yes | No | No |
| ligand | ligand | Ramilowski2015 | Yes | No | Yes | No | No |
| ligand | ligand | LRdb | Yes | No | Yes | No | No |
Protein Complex Composition (3)
Sequence, Structure & Domains9
Sequences
Length
1,375
Mass
151,254
Sequence
MEGDRVAGRPVLSSLPVLLLLPLLMLRAAALHPDELFPHGESWGDQLLQEGDDESSAVVKLANPLHFYEARFSNLYVGTNGIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRGRVLYREDTSPAVLGLAARYVRAGFPRSARFTPTHAFLATWEQVGAYEEVKRGALPSGELNTFQAVLASDGSDSYALFLYPANGLQFLGTRPKESYNVQLQLPARVGFCRGEADDLKSEGPYFSLTSTEQSVKNLYQLSNLGIPGVWAFHIGSTSPLDNVRPAAVGDLSAAHSSVPLGRSFSHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKPLEESSTLDPHTKEGTSLGEVGGPDLKGQVEPWDERETRSPAPPEVDRDSLAPSWETPPPYPENGSIQPYPDGGPVPSEMDVPPAHPEEEIVLRSYPASGHTTPLSRGTYEVGLEDNIGSNTEVFTYNAANKETCEHNHRQCSRHAFCTDYATGFCCHCQSKFYGNGKHCLPEGAPHRVNGKVSGHLHVGHTPVHFTDVDLHAYIVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPGSENGFSLAGAAFTHDMEVTFYPGEETVRITQTAEGLDPENYLSIKTNIQGQVPYVSANFTAHISPYKELYHYSDSTVTSTSSRDYSLTFGAINQTWSYRIHQNITYQVCRHAPRHPSFPTTQQLNVDRVFALYNDEERVLRFAVTNQIGPVKEDSDPTPGNPCYDGSHMCDTTARCHPGTGVDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHTCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTDVDECSENRCHPAATCYNTPGSFSCRCQPGYYGDGFQCIPDSTSSLTPCEQQQRHAQAQYAYPGARFHIPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMVRPTPRPDVTPPSVGTFLLYTQGQQIGYLPLNGTRLQKDAAKTLLSLHGSIIVGIDYDCRERMVYWTDVAGRTISRAGLELGAEPETIVNSGLISPEGLAIDHIRRTMYWTDSVLDKIESALLDGSERKVLFYTDLVNPRAIAVDPIRGNLYWTDWNREAPKIETSSLDGENRRILINTDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSIVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q14112-1; Sequence=Displayed; Name=2; IsoId=Q14112-2; Sequence=VSP_038779, VSP_038780
Alternative Sequence
7..59; Missing (in isoform 2); 844..892; LITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTD -> Y (in isoform 2)
Domain & Motif Annotations
Compositional Bias
386..403; Basic and acidic residues; 999..1014; Pro residues
Repeat
1154..1197; LDL-receptor class B 1; 1198..1240; LDL-receptor class B 2; 1241..1285; LDL-receptor class B 3; 1286..1327; LDL-receptor class B 4; 1329..1373; LDL-receptor class B 5
Domain (FT)
108..273; NIDO; 484..524; EGF-like 1; 528..758; Nidogen G2 beta-barrel; 759..800; EGF-like 2; 801..843; EGF-like 3; calcium-binding; 848..891; EGF-like 4; 892..930; EGF-like 5; calcium-binding; 937..1005; Thyroglobulin type-1 1; 1016..1084; Thyroglobulin type-1 2
Region
348..437; Disordered; 992..1016; Disordered
Clinical Relevance4
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 35119778 | Optimization of small extracellular vesicle isolation from expressed prostatic secretions in urine for in-depth proteomic analysis. | No abstract available |
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No abstract available |