Protein detail

MPP2

MAGUK p55 subfamily member 2 (Discs large homolog 2) (Protein MPP2)

Entry name MPP2	UniProt ID Q14168	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

MAGUK p55 subfamily member 2 (Discs large homolog 2) (Protein MPP2)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000150672

Entrez Gene Symbol

DLG2

Gene Synonym (4)

chapsyn-110PPP1R58PSD-93PSD93

Gene Description

Discs large MAGUK scaffold protein 2

Chromosome

Position

83455012-85628335

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Tissue SpecificliverCell SpecificCardiomyocytes

Function & Pathway8

Protein Function

Predicted intracellular proteins

Cellular Component (13)

Page 1 of 2

Molecular Function (5)

Biological Process (3)

KEGG (3)

Reactome (14)

Page 1 of 2

Canonical Pathways (3)

M26 Pid nfkappab atypical pathway
M211 Pid hedgehog 2pathway
M185 Pid alk1 pathway

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence17

Enzyme-Mediated Modification (3)

3 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
DLG2	FYN	P06241	Y	348	phosphorylation	KEASIGNOR	SIGNOR:13129934 KEA:13129934
DLG2	MAPK1	P28482	S	323	phosphorylation	Sparser_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper	ProtMapper:22618309
DLG2	MAPK1	P28482	S	428	phosphorylation	MIMPPhosphoSite_MIMP

Ligand-Receptor Signaling (10)

10 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
ion_channel	ion_channel	DGIdb	No	Yes	No	No	No
transporter	transporter	OmniPath	No	Yes	No	No	No
ion_channel	ion_channel	OmniPath	No	Yes	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
FYN	P06241	DLG2	Q15700	Yes	Yes	No	WangSIGNORProtMapperCui2007KEACA1phosphoELM_KEASIGNOR_ProtMapper	CA1:13129934 ProtMapper:13129934 SIGNOR:13129934 KEA:13129934
MK01	P28482	DLG2	Q15700	Yes	No	No	Sparser_ProtMapperPhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:22618309 PhosphoSite:22618309

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	DLG2	Q15700	2	PDB	PDB:2he2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometrySmall R sequencing (Illumi HiSeq 2000 (Solexa)	1	27605433

Sequence, Structure & Domains11

Sequences

Length

576

Mass

64,581

Sequence

MPVAATNSETAMQQVLDNLGSLPSATGAAELDLIFLRGIMESPIVRSLAKVIMVLWFMQQNVFVPMKYMLKYFGAHERLEETKLEAVRDNNLELVQEILRDLAHVAEQSSTAAELAHILQEPHFQSLLETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELVIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRNASGSVILKILPSYQEPHLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY

Alternative Products

Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q14168-1; Sequence=Displayed; Name=2; IsoId=Q14168-2; Sequence=VSP_003156; Name=3; IsoId=Q14168-3; Sequence=VSP_022951, VSP_003156; Name=4; IsoId=Q14168-4; Sequence=VSP_055138, VSP_003156; Name=5; IsoId=Q14168-5; Sequence=VSP_055136; Name=6; IsoId=Q14168-6; Sequence=VSP_055137, VSP_003156

Alternative Sequence

1..163; Missing (in isoform 5); 1..11; Missing (in isoform 6); 1..10; MPVAATNSET -> MAGSPGSGVSLEGISLESSEEAELQRE (in isoform 3); 1; M -> MSWAPPPQVGQNLRSQTVLRILNGMEDLMWVAMEERRFRALASFTM (in isoform 4); 51..74; Missing (in isoform 2, isoform 3, isoform 4 and isoform 6)

3D Structural Models

Helix

196..200; 221..229

Beta Strand

177..191; 193..195; 208..212; 233..235; 237..240

3D Structure

NMR spectroscopy (1)

Domain & Motif Annotations

Domain (FT)

8..60; L27 1; 84..142; L27 2; 185..240; PDZ; 249..317; SH3; 374..561; Guanylate kinase-like

Protein Families

MAGUK family

Sequence Similarities

Belongs to the MAGUK family.

Clinical Relevance2

Drugs

ANASTROZOLE

Antibody (3)

HPA021307 HPA023896 CAB072341

Supporting Publications1

PMID	Title	Abstract
35399949	Integration of Metabolomics and Proteomics in Exploring the Endothelial Dysfunction Mechanism Induced by Serum Exosomes From Diabetic Retinopathy and Diabetic Nephropathy Patients.	No abstract available