Protein detail
MPP2
MAGUK p55 subfamily member 2 (Discs large homolog 2) (Protein MPP2)
Entry name MPP2 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
MAGUK p55 subfamily member 2 (Discs large homolog 2) (Protein MPP2)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
chapsyn-110PPP1R58PSD-93PSD93
Gene Description
Discs large MAGUK scaffold protein 2
Chromosome
11
Position
83455012-85628335
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificliverCell SpecificCardiomyocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005912 adherens junction
- GO:0008076 voltage-gated potassium channel complex
- GO:0014069 postsynaptic density
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0031594 neuromuscular junction
- GO:0043005 neuron projection
- GO:0043204 perikaryon
- GO:0044224 juxtaparanode region of axon
- GO:0098839 postsynaptic density membrane
- GO:1904115 axon cytoplasm
Molecular Function
Biological Process
KEGG
Reactome
- R-hsa-442755 activation of nmda receptors and postsynaptic events
- R-hsa-9609736 assembly and cell surface presentation of nmda receptors
- R-hsa-442742 creb1 phosphorylation through nmda receptor mediated activation of ras signaling
- R-hsa-9620244 long term potentiation
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-9617324 negative regulation of nmda receptor mediated neuronal transmission
- R-hsa-6794361 neurexins and neuroligins
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-6794362 protein protein interactions at synapses
- R-hsa-442982 ras activation upon ca2 influx through nmda receptor
- R-hsa-112315 transmission across chemical synapses
- R-hsa-438066 unblocking of nmda receptors glutamate binding and activation
Canonical Pathways
- M26 Pid nfkappab atypical pathway
- M211 Pid hedgehog 2pathway
- M185 Pid alk1 pathway
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DLG2 | FYN | P06241 | Y | 348 | phosphorylation | KEASIGNOR | SIGNOR:13129934KEA:13129934 |
| DLG2 | MAPK1 | P28482 | S | 323 | phosphorylation | Sparser_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:22618309 |
| DLG2 | MAPK1 | P28482 | S | 428 | phosphorylation | MIMPPhosphoSite_MIMP |
Ligand-Receptor Signaling
10 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| ion_channel | ion_channel | DGIdb | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| ion_channel | ion_channel | OmniPath | No | Yes | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FYN | P06241 | DLG2 | Q15700 | Yes | Yes | No | WangSIGNORProtMapperCui2007KEACA1phosphoELM_KEASIGNOR_ProtMapper | CA1:13129934ProtMapper:13129934SIGNOR:13129934KEA:13129934 |
| MK01 | P28482 | DLG2 | Q15700 | Yes | No | No | Sparser_ProtMapperPhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:22618309PhosphoSite:22618309 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometrySmall R sequencing (Illumi HiSeq 2000 (Solexa) | 1 | 27605433 |
Sequence, Structure & Domains
Sequences
Length
576
Mass
64,581
Sequence
MPVAATNSETAMQQVLDNLGSLPSATGAAELDLIFLRGIMESPIVRSLAKVIMVLWFMQQNVFVPMKYMLKYFGAHERLEETKLEAVRDNNLELVQEILRDLAHVAEQSSTAAELAHILQEPHFQSLLETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELVIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRNASGSVILKILPSYQEPHLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q14168-1; Sequence=Displayed; Name=2; IsoId=Q14168-2; Sequence=VSP_003156; Name=3; IsoId=Q14168-3; Sequence=VSP_022951, VSP_003156; Name=4; IsoId=Q14168-4; Sequence=VSP_055138, VSP_003156; Name=5; IsoId=Q14168-5; Sequence=VSP_055136; Name=6; IsoId=Q14168-6; Sequence=VSP_055137, VSP_003156
Alternative Sequence
1..163; Missing (in isoform 5); 1..11; Missing (in isoform 6); 1..10; MPVAATNSET -> MAGSPGSGVSLEGISLESSEEAELQRE (in isoform 3); 1; M -> MSWAPPPQVGQNLRSQTVLRILNGMEDLMWVAMEERRFRALASFTM (in isoform 4); 51..74; Missing (in isoform 2, isoform 3, isoform 4 and isoform 6)
3D Structural Models
Helix
196..200; 221..229
Beta Strand
177..191; 193..195; 208..212; 233..235; 237..240
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Domain (FT)
8..60; L27 1; 84..142; L27 2; 185..240; PDZ; 249..317; SH3; 374..561; Guanylate kinase-like
Protein Families
MAGUK family
Sequence Similarities
Belongs to the MAGUK family.
Clinical Relevance
Drugs