Protein detail
AGRE1
Adhesion G protein-coupled receptor E1 (EGF-like module receptor 1) (EGF-like module-containing mucin-like hormone receptor-like 1) (EMR1 hormone receptor)
Protein symbol AGRE1 | UniProt ID | EVMP score 0.38 |
Frequency | Transmembrane count 7 | Protein classification G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Adhesion G protein-coupled receptor E1 (EGF-like module receptor 1) (EGF-like module-containing mucin-like hormone receptor-like 1) (EMR1 hormone receptor)
Protein Class
G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- G-protein coupled receptors:Family 2 (B) receptors
- Transporters
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
600..627; Helical; Name=1; 635..656; Helical; Name=2; 667..690; Helical; Name=3; 710..731; Helical; Name=4; 748..776; Helical; Name=5; 795..814; Helical; Name=6; 830..852; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym
EMR1TM7LN3
Gene Description
Adhesion G protein-coupled receptor E1
Chromosome
19
Position
6887566-6940459
EVMP Score
0.38
Fluorescence & Localization
Cell SpecificAdrenal medulla cellsSingle-Nuclei Brain Specificoligodendrocyte
Function & Pathway
Protein Function
- G-protein coupled receptors:Family 2 (B) receptors
- Transporters
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Biological Process
Reactome
Mediation Categories
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| gpcr | receptor | GPCRdb | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 5 of 5Previous
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity CaptureMicrofluidics-Based Methods | Mass spectrometry | 36 | 323849373418624333035814346223203994949039766158399406413150850036398564377869183822545338556629398737264106344140545963348179063279541438731868289865852680191927605433305502873060870033709510273124283832153540098346412010902914823930760538313205913208974341216884403116163983538640091455 |
Sequence, Structure & Domains
Sequences
Length
886
Mass
97,683
Sequence
MRGFNLLLFWGCCVMHSWEGHIRPTRKPNTKGNNCRDSTLCPAYATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSCQVGFISRNSTCEDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECTEMCPINSTCTNTPGSYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGFHPNPEGSQKDGNFSCQRVLFKCKEDVIPDNKQIQQCQEGTAVKPAYVSFCAQINNIFSVLDKVCENKTTVVSLKNTTESFVPVLKQISTWTKFTKEETSSLATVFLESVESMTLASFWKPSANITPAVRTEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGELTMDFSLYIISHVGIIISLVCLVLAIATFLLCRSIRNHNTYLHLHLCVCLLLAKTLFLAGIHKTDNKMGCAIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVVNYFSSRNIKMLHICAFGYGLPMLVVVISASVQPQGYGMHNRCWLNTETGFIWSFLGPVCTVIVINSLLLTWTLWILRQRLSSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGIFQIGPVAGVMAYLFTIINSLQGAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG
Alternative Products
Event=Alternative splicing; Named isoforms=5; Comment=Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q14246-1; Sequence=Displayed; Name=2; IsoId=Q14246-2; Sequence=VSP_009594; Name=3; IsoId=Q14246-3; Sequence=VSP_045521, VSP_045524; Name=4; IsoId=Q14246-4; Sequence=VSP_045523; Name=5; IsoId=Q14246-5; Sequence=VSP_045521, VSP_045522
Alternative Sequence
80..131; Missing (in isoform 3 and isoform 5); 132..220; Missing (in isoform 5); 140..316; Missing (in isoform 4); 599..663; Missing (in isoform 2); 764; I -> VSKYYNSLAKCVLKEEQGDLRDLEFPGTCAAERI (in isoform 3)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
863..886; Polar residues
Domain (FT)
31..79; EGF-like 1; 80..131; EGF-like 2; calcium-binding; 132..171; EGF-like 3; calcium-binding; 172..220; EGF-like 4; calcium-binding; 221..267; EGF-like 5; calcium-binding; 268..316; EGF-like 6; calcium-binding; 431..597; GAIN-B
Region
550..597; GPS; 862..886; Disordered
Protein Families
- G-protein coupled receptor 2 family
- Adhesion G-protein coupled receptor (ADGR) subfamily
Sequence Similarities
Belongs to the G-protein coupled receptor 2 family. Adhesion G-protein coupled receptor (ADGR) subfamily.