Protein detail
SRC8
Src substrate cortactin (Amplaxin) (Oncogene EMS1)
Entry name SRC8 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 7 | Transmembrane count | Protein classification Cancer-related genesPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Src substrate cortactin (Amplaxin) (Oncogene EMS1)
Protein Class (3)
Cancer-related genesPlasma proteinsPredicted intracellular proteins
Protein Function (2)
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
EMS1
Gene Description
Cortactin
Chromosome
11
Position
70398404-70436584
Supporting publications (n)
7
EVMP confidence score
0.63
Fluorescence & Localization1
Cell SpecificEarly spermatids
Function & Pathway7
Protein Function (2)
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
Cellular Component (20)
- GO:0001726 ruffle
- GO:0002102 podosome
- GO:0005737 cytoplasm
- GO:0005783 endoplasmic reticulum
- GO:0005794 Golgi apparatus
- GO:0005829 cytosol
- GO:0005856 cytoskeleton
- GO:0005884 actin filament
- GO:0005886 plasma membrane
- GO:0005905 clathrin-coated pit
Page 1 of 2
Molecular Function (3)
Biological Process (3)
KEGG (5)
Reactome (6)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence237
Enzyme-Mediated Modification (193)
193 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CTTN | CDKL3 | Q8IVW4 | T | 364 | phosphorylation | PhosphoNetworks | |
| CTTN | CDKL3 | Q8IVW4 | S | 368 | phosphorylation | PhosphoNetworks | |
| CTTN | CDKL3 | Q8IVW4 | S | 381 | phosphorylation | PhosphoNetworks | |
| CTTN | DYRK4 | Q9NR20 | T | 364 | phosphorylation | PhosphoNetworks | |
| CTTN | DYRK4 | Q9NR20 | S | 380 | phosphorylation | PhosphoNetworks | |
| CTTN | DYRK4 | Q9NR20 | Y | 416 | phosphorylation | PhosphoNetworks | |
| CTTN | STK38 | Q15208 | T | 374 | phosphorylation | PhosphoNetworks | |
| CTTN | WEE1 | P30291 | T | 374 | phosphorylation | PhosphoNetworks | |
| CTTN | WEE1 | P30291 | S | 380 | phosphorylation | PhosphoNetworks | |
| CTTN | WEE1 | P30291 | Y | 501 | phosphorylation | PhosphoNetworks |
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| actin_regulation_adhesome | intracellular_intercellular_related | Adhesome | Yes | No | No | No | No |
| intracellular_intercellular_related | intracellular_intercellular_related | OmniPath | Yes | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network (23)
23 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SRC8 | Q14247 | COMPLEX:O15144_O15145_O15511_P59998_P61158_P61160_Q92747 | Yes | Yes | No | SIGNOR | SIGNOR:11231575 | |
| KPCD3 | O94806 | SRC8 | Q14247 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:24753582PhosphoSite:31727638PhosphoSite:19038333PhosphoSite:27179075PhosphoSite:20363754 |
| CDK2 | P24941 | SRC8 | Q14247 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_ProtMapperHPRD_MIMPiPTMnetProtMapperKEAPhosphoSiteNetworKIN_KEA | PhosphoSite:21856159PhosphoSite:21079800PhosphoSite:26490115PhosphoSite:24867096PhosphoSite:20444238PhosphoSite:10537323PhosphoSite:24188565KEA:17570479PhosphoSite:27363897 |
Page 3 of 3Previous
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CTTN-FER-PTK2 complex | CTTNFERPTK2 | P16591Q05397Q14247 | 0:0:0 | CORUM | CORUM:6916 | 19339212 |
| G alpha-13-Hax-1-cortactin-Rac complex | AKT1CTTNGNA13HAX1 | O00165P31749Q14247Q14344 | 0:0:0:0 | CORUM | CORUM:6282 | 15339924 |
| c-Abl-cortactin-nmMLCK complex | ABL1CTTNMYLK | P00519Q14247Q15746 | 0:0:0 | CORUM | CORUM:6076 | 20861316 |
| CTTNWIPF1 | O43516Q14247 | 1:1 | PDB | PDB:9eznPDB:9ezpPDB:9ezo | ||
| C19orf53CTTNHNRNPUSPATS2 | Q00839Q14247Q86XZ4Q9UNZ5 | 0:0:0:0 | hu.MAP | |||
| C19orf53CTTNHNRNPUTHAP11 | Q00839Q14247Q96EK4Q9UNZ5 | 0:0:0:0 | hu.MAP | |||
| CTTNPRRC2BPRRC2C | Q14247Q5JSZ5Q9Y520 | 0:0:0 | hu.MAP2 |
Sequence, Structure & Domains14
Sequences
Length
550
Mass
61,586
Sequence
MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q14247-1; Sequence=Displayed; Name=2; IsoId=Q14247-2; Sequence=VSP_043120, VSP_043121; Name=3; IsoId=Q14247-3; Sequence=VSP_043120
Alternative Sequence
264..300; Missing (in isoform 2 and isoform 3); 538..550; YGLFPANYVELRQ -> FRELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKDCPRRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWEICLCHTVTARRIRKLISFLRSREAGPVPSCSQVGGVSFQKVTWKCLGTWVPECP (in isoform 2)
3D Structural Models
Helix
543..545
Beta Strand
497..499; 506..510; 518..523; 526..534; 537..542; 546..548
3D Structure
NMR spectroscopy (4); X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
17..27; Acidic residues; 357..396; Basic and acidic residues
Repeat
80..116; Cortactin 1; 117..153; Cortactin 2; 154..190; Cortactin 3; 191..227; Cortactin 4; 228..264; Cortactin 5; 265..301; Cortactin 6; 302..324; Cortactin 7; truncated
Coiled Coil
348..401
Domain (CC)
The SH3 motif may mediate binding to the cytoskeleton.
Domain (FT)
492..550; SH3
Region
1..27; Disordered; 344..419; Disordered
Clinical Relevance6
Disease Involvement
Cancer-related genes
Drugs (2)
Interaction Protein (14)
ENSG00000094631ENSG00000111229ENSG00000113758ENSG00000115091ENSG00000126016ENSG00000136068ENSG00000136754ENSG00000138071ENSG00000146648ENSG00000153317ENSG00000159251ENSG00000163466ENSG00000196924ENSG00000198898
Interaction Count
14
Interaction Dataset (2)
intact_biogridbiogrid_opencell
Supporting Publications7
| PMID | Title | Abstract |
|---|---|---|
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No abstract available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No abstract available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No abstract available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No abstract available |