Protein detail

SRC8

Src substrate cortactin (Amplaxin) (Oncogene EMS1)

Entry name SRC8	UniProt ID Q14247	EVMP confidence score 0.63
Supporting publications (n) 7	Transmembrane count	Protein classification Cancer-related genesPlasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Src substrate cortactin (Amplaxin) (Oncogene EMS1)

Protein Class (3)

Cancer-related genesPlasma proteinsPredicted intracellular proteins

Protein Function (2)

Cancer-related genes:Mutational cancer driver genes
Predicted intracellular proteins

Ensembl

ENSG00000085733

Entrez Gene Symbol

CTTN

Gene Synonym

EMS1

Gene Description

Cortactin

Chromosome

Position

70398404-70436584

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization1

Cell SpecificEarly spermatids

Function & Pathway7

Protein Function (2)

Cancer-related genes:Mutational cancer driver genes
Predicted intracellular proteins

Cellular Component (20)

Page 1 of 2

Molecular Function (3)

Biological Process (3)

KEGG (5)

Reactome (6)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence237

Enzyme-Mediated Modification (193)

193 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
CTTN	PAK1	Q13153	S	381	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
CTTN	PRKD1	Q15139	S	348	phosphorylation	SIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:19038333 SIGNOR:19038333
CTTN	PRKD1	Q15139	S	298	phosphorylation	Sparser_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:19038333 ProtMapper:20363754 SIGNOR:20363754 ProtMapper:29152154
CTTN	PRKD1	Q15139	S	311	phosphorylation	MIMPHPRD_MIMPPhosphoSite_MIMP
CTTN	PRKD1	Q15139	S	113	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:26490115
CTTN	PTPN1	P18031	Y	446	dephosphorylation	SIGNORDEPOD	SIGNOR:18387954 DEPOD:18387954
CTTN	PTPN1	P18031	Y	421	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:27824079
CTTN	PTPN1	P18031	Y	446	phosphorylation	SIGNOR_ProtMapperProtMapper	ProtMapper:18387954
CTTN	PRKCD	Q05655	S	405	phosphorylation	SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper	SIGNOR:26490115
CTTN	FER	P16591	Y	421	phosphorylation	NCI-PID_ProtMapperProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:27758765 HPRD:18707149 HPRD:19413330 HPRD:9748248 HPRD:18491316 HPRD:18669648 HPRD:17287340 KEA:15169891 HPRD:16497976 HPRD:10921917 HPRD:17016520 HPRD:20068231 KEA:15592455 KEA:9748248 KEA:12522270 HPRD:18088087 ProtMapper:16176974 KEA:10921917 HPRD:17389395 ProtMapper:10921917

Page 4 of 20Previous Next

Ligand-Receptor Signaling (13)

13 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	No	No
adhesion	adhesion	OmniPath	Yes	Yes	No	No	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	No	No
actin_regulation_adhesome	intracellular_intercellular_related	Adhesome	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No

Page 1 of 2Next

Regulatory Interaction Network (23)

23 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ABL1	P00519	SRC8	Q14247	Yes	Yes	No	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperSPIKE_LCSPIKEPhosphoSite_ProtMapper	SPIKE:17306540 SPIKE_LC:20841568 ProtMapper:20861316 SPIKE_LC:17306540 SPIKE:20841568 SIGNOR:20861316
SRC	P12931	SRC8	Q14247	Yes	Yes	Yes	KEGG-MEDICUSHPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperdbPTMPhosphoSite_KEAphosphoELM_KEAInnateDBHPRDCui2007CA1WangPhosphoSite_ProtMapperNetworKIN_KEABEL-Large-Corpus_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteSparser_ProtMapperAdhesomeHPRD-phos	ProtMapper:27758765 ProtMapper:25682866 HPRD:9748248 ProtMapper:28769876 KEA:17570479 ProtMapper:25077552 Adhesome:11389697 ProtMapper:9748248 phosphoELM:9748248 HPRD-phos:18088087 ProtMapper:24465712 ProtMapper:28522963 dbPTM:19534553 HPRD-phos:18669648 SIGNOR:15169891 ProtMapper:18707149 CA1:7680654 PhosphoSite:16212419 ProtMapper:12601080 ProtMapper:15169891 ProtMapper:18491316 ProtMapper:19413330 ProtMapper:24675741 ProtMapper:29515177 ProtMapper:32498343 HPRD-phos:9748248 ProtMapper:27009365 HPRD-phos:18491316 Adhesome:9748248 ProtMapper:17016520 KEA:15169891 HPRD-phos:10921917 HPRD-phos:20068231 ProtMapper:29172953 dbPTM:19413330 ProtMapper:18088087 ProtMapper:22761768 ProtMapper:17292556 ProtMapper:17389395 dbPTM:17389395 InnateDB:11389697 dbPTM:19690332 ProtMapper:19419567 KEA:18088087 ProtMapper:19273217 KEA:15592455 KEA:9748248 ProtMapper:17287340 ProtMapper:22952866 dbPTM:17287340 HPRD-phos:18707149 ProtMapper:26142315 KEA:12522270 dbPTM:18088087 Adhesome:7680654 HPRD-phos:17389395 ProtMapper:16497976 Adhesome:9683637 ProtMapper:22823952 ProtMapper:27603901 HPRD-phos:17287340 ProtMapper:20068231 HPRD-phos:16497976 HPRD-phos:19413330 SIGNOR:12601080 ProtMapper:18669648 KEA:10921917 ProtMapper:16162656 HPRD-phos:17016520 dbPTM:12522270 ProtMapper:10921917
MK01	P28482	SRC8	Q14247	Yes	Yes	No	WangPhosphoNetworksphosphoELM_MIMPAdhesomeMIMPPhosphoSite_MIMPHPRD_MIMPPhosphoSite_ProtMapperSIGNORiPTMnetProtMapperKEASIGNOR_ProtMapperNetworKIN_KEA	ProtMapper:21079800 SIGNOR:21079800 Adhesome:22514278 SIGNOR:20444238 KEA:17570479 ProtMapper:20444238
PAK1	Q13153	SRC8	Q14247	Yes	Yes	No	WangSparser_ProtMapperphosphoELM_MIMPAdhesomeMIMPPhosphoSite_MIMPHPRD_MIMPiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperReactome_ProtMapperInnateDBSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperSPIKE_LC	SPIKE_LC:18344974 InnateDB:12453877 ProtMapper:27135389 ProtMapper:20444238 ProtMapper:21079800 Adhesome:18344974 ProtMapper:24859002 SIGNOR:21079800 ProtMapper:29172953 ProtMapper:29152154 Adhesome:12453877 Adhesome:16854367 ProtMapper:26490115 SIGNOR:20444238 PhosphoSite:30562756 PhosphoSite:24859002
MK03	P27361	SRC8	Q14247	Yes	Yes	No	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper	KEA:16964243 KEA:15144186 KEA:10537323 ProtMapper:21079800 phosphoELM:10537323 KEA:18088087 SIGNOR:21079800 KEA:17081983 SIGNOR:20444238 ProtMapper:20444238
	COMPLEX:Q05586_Q14957	SRC8	Q14247	Yes	Yes	No	SIGNOR	SIGNOR:14684878
FAK1	Q05397	SRC8	Q14247	Yes	Yes	Yes	Sparser_ProtMapperAdhesomeSIGNORProtMapperRLIMS-P_ProtMapperWangREACH_ProtMapper	SIGNOR:22952866 Adhesome:17893324 ProtMapper:22952866
FAK2	Q14289	SRC8	Q14247	Yes	Yes	No	PhosphoNetworksSparser_ProtMapperSIGNORProtMapperWangREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:29643476 PhosphoSite:25077552 ProtMapper:29133485 PhosphoSite:18387954 PhosphoSite:29133485 PhosphoSite:30837395 PhosphoSite:34088320 PhosphoSite:21696810 PhosphoSite:9748248 SIGNOR:29133485 PhosphoSite:24465712 PhosphoSite:25198505 PhosphoSite:25682866
KPCD	Q05655	SRC8	Q14247	Yes	Yes	No	iPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:26490115 SIGNOR:26490115
DIP2A	Q14689	SRC8	Q14247	Yes	Yes	No	SIGNOR	SIGNOR:31600191

Page 1 of 3Next

Protein Complex Composition (7)

7 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
CTTN-FER-PTK2 complex	CTTN FER PTK2	P16591 Q05397 Q14247	0:0:0	CORUM	CORUM:6916	19339212
G alpha-13-Hax-1-cortactin-Rac complex	AKT1 CTTN GNA13 HAX1	O00165 P31749 Q14247 Q14344	0:0:0:0	CORUM	CORUM:6282	15339924
c-Abl-cortactin-nmMLCK complex	ABL1 CTTN MYLK	P00519 Q14247 Q15746	0:0:0	CORUM	CORUM:6076	20861316
	CTTN WIPF1	O43516 Q14247	1:1	PDB	PDB:9eznPDB:9ezpPDB:9ezo
	C19orf53 CTTN HNRNPU SPATS2	Q00839 Q14247 Q86XZ4 Q9UNZ5	0:0:0:0	hu.MAP
	C19orf53 CTTN HNRNPU THAP11	Q00839 Q14247 Q96EK4 Q9UNZ5	0:0:0:0	hu.MAP
	CTTN PRRC2B PRRC2C	Q14247 Q5JSZ5 Q9Y520	0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	3	38113368 33304478 36146834

Sequence, Structure & Domains14

Sequences

Length

550

Mass

61,586

Sequence

MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q14247-1; Sequence=Displayed; Name=2; IsoId=Q14247-2; Sequence=VSP_043120, VSP_043121; Name=3; IsoId=Q14247-3; Sequence=VSP_043120

Alternative Sequence

264..300; Missing (in isoform 2 and isoform 3); 538..550; YGLFPANYVELRQ -> FRELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKDCPRRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWEICLCHTVTARRIRKLISFLRSREAGPVPSCSQVGGVSFQKVTWKCLGTWVPECP (in isoform 2)

3D Structural Models

Helix

543..545

Beta Strand

497..499; 506..510; 518..523; 526..534; 537..542; 546..548

3D Structure

NMR spectroscopy (4); X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

17..27; Acidic residues; 357..396; Basic and acidic residues

Repeat

80..116; Cortactin 1; 117..153; Cortactin 2; 154..190; Cortactin 3; 191..227; Cortactin 4; 228..264; Cortactin 5; 265..301; Cortactin 6; 302..324; Cortactin 7; truncated

Coiled Coil

348..401

Domain (CC)

The SH3 motif may mediate binding to the cytoskeleton.

Domain (FT)

492..550; SH3

Region

1..27; Disordered; 344..419; Disordered

Clinical Relevance6

Disease Involvement

Cancer-related genes

Drugs (2)

GSK2606414 GSK2656157

Antibody (2)

CAB011235 HPA057242

Interaction Protein (14)

ENSG00000094631ENSG00000111229ENSG00000113758ENSG00000115091ENSG00000126016ENSG00000136068ENSG00000136754ENSG00000138071ENSG00000146648ENSG00000153317ENSG00000159251ENSG00000163466ENSG00000196924ENSG00000198898

Interaction Count

Interaction Dataset (2)

intact_biogridbiogrid_opencell

Supporting Publications7

PMID	Title	Abstract
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No abstract available