EV MemProt Atlas

Basic Information11

Protein Names

Src substrate cortactin (Amplaxin) (Oncogene EMS1)

Protein Class (3)

Cancer-related genesPlasma proteinsPredicted intracellular proteins

Protein Function (2)

Cancer-related genes:Mutational cancer driver genes
Predicted intracellular proteins

Ensembl

ENSG00000085733

Entrez Gene Symbol

CTTN

Gene Synonym

EMS1

Gene Description

Cortactin

Chromosome

11

Position

70398404-70436584

Supporting publications (n)

7

EVMP confidence score

0.63

Fluorescence & Localization1

Cell SpecificEarly spermatids

Function & Pathway7

Protein Function (2)

Cancer-related genes:Mutational cancer driver genes
Predicted intracellular proteins

Cellular Component (20)

Page 1 of 2

Molecular Function (3)

Biological Process (3)

KEGG (5)

Reactome (6)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence237

Enzyme-Mediated Modification (193)

193 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
CTTN	FGFR1	P11362	Y	433	phosphorylation	PhosphoNetworks
CTTN	FGFR1	P11362	Y	501	phosphorylation	PhosphoNetworks
CTTN	MAPK3	P27361	S	418	phosphorylation	SIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	KEA:16964243 KEA:10537323 ProtMapper:21079800 phosphoELM:10537323 KEA:18088087 SIGNOR:21079800 KEA:17081983 SIGNOR:20444238 ProtMapper:20444238
CTTN	MAPK3	P27361	S	405	phosphorylation	SIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	KEA:15144186 KEA:10537323 ProtMapper:21079800 phosphoELM:10537323 KEA:18088087 SIGNOR:21079800 KEA:17081983 SIGNOR:20444238 ProtMapper:20444238
CTTN	MAPK3	P27361	T	364	phosphorylation	PhosphoNetworks
CTTN	MAPK3	P27361	S	368	phosphorylation	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMP
CTTN	MAPK3	P27361	S	381	phosphorylation	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMP
CTTN	SRC	P12931	Y	486	phosphorylation	BEL-Large-Corpus_ProtMapperSparser_ProtMapperSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:9748248 HPRD:9748248 phosphoELM:9748248 ProtMapper:22823952 ProtMapper:24465712 ProtMapper:28522963 SIGNOR:12601080 KEA:9748248 KEA:17570479 ProtMapper:12601080 ProtMapper:22761768 ProtMapper:19273217
CTTN	SRC	P12931	Y	470	phosphorylation	BEL-Large-Corpus_ProtMapperSparser_ProtMapperSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:27009365 ProtMapper:9748248 HPRD:9748248 ProtMapper:28769876 ProtMapper:25077552 phosphoELM:9748248 ProtMapper:22823952 ProtMapper:24465712 ProtMapper:28522963 SIGNOR:12601080 KEA:9748248 KEA:17570479 ProtMapper:12601080 ProtMapper:22761768 ProtMapper:19273217
CTTN	SRC	P12931	Y	421	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperdbPTMKEASIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:27758765 HPRD:18707149 HPRD:19413330 HPRD:9748248 ProtMapper:25682866 ProtMapper:25077552 ProtMapper:24465712 ProtMapper:28522963 dbPTM:19534553 HPRD:18491316 SIGNOR:15169891 HPRD:18669648 HPRD:17287340 ProtMapper:15169891 ProtMapper:24675741 ProtMapper:27009365 KEA:15169891 HPRD:16497976 dbPTM:19413330 ProtMapper:22761768 HPRD:10921917 HPRD:17016520 dbPTM:17389395 KEA:10921917 dbPTM:19690332 HPRD:20068231 KEA:18088087 ProtMapper:19419567 ProtMapper:19273217 KEA:15592455 KEA:9748248 dbPTM:17287340 ProtMapper:26142315 dbPTM:18088087 KEA:12522270 ProtMapper:27603901 ProtMapper:22823952 HPRD:18088087 KEA:17570479 dbPTM:12522270 ProtMapper:16162656 HPRD:17389395

Page 1 of 20Next

Ligand-Receptor Signaling (13)

13 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	No	No
adhesion	adhesion	OmniPath	Yes	Yes	No	No	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	No	No
actin_regulation_adhesome	intracellular_intercellular_related	Adhesome	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No

Page 1 of 2Next

Regulatory Interaction Network (23)

23 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
SRC8	Q14247		COMPLEX:O15144_O15145_O15511_P59998_P61158_P61160_Q92747	Yes	Yes	No	SIGNOR	SIGNOR:11231575
KPCD3	O94806	SRC8	Q14247	Yes	No	No	PhosphoSitePhosphoSite_ProtMapperProtMapper	PhosphoSite:24753582 PhosphoSite:31727638 PhosphoSite:19038333 PhosphoSite:27179075 PhosphoSite:20363754
CDK2	P24941	SRC8	Q14247	Yes	No	No	phosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_ProtMapperHPRD_MIMPiPTMnetProtMapperKEAPhosphoSiteNetworKIN_KEA	PhosphoSite:21856159 PhosphoSite:21079800 PhosphoSite:26490115 PhosphoSite:24867096 PhosphoSite:20444238 PhosphoSite:10537323 PhosphoSite:24188565 KEA:17570479 PhosphoSite:27363897

Page 3 of 3Previous

Protein Complex Composition (7)

7 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
CTTN-FER-PTK2 complex	CTTN FER PTK2	P16591 Q05397 Q14247	0:0:0	CORUM	CORUM:6916	19339212
G alpha-13-Hax-1-cortactin-Rac complex	AKT1 CTTN GNA13 HAX1	O00165 P31749 Q14247 Q14344	0:0:0:0	CORUM	CORUM:6282	15339924
c-Abl-cortactin-nmMLCK complex	ABL1 CTTN MYLK	P00519 Q14247 Q15746	0:0:0	CORUM	CORUM:6076	20861316
	CTTN WIPF1	O43516 Q14247	1:1	PDB	PDB:9eznPDB:9ezpPDB:9ezo
	C19orf53 CTTN HNRNPU SPATS2	Q00839 Q14247 Q86XZ4 Q9UNZ5	0:0:0:0	hu.MAP
	C19orf53 CTTN HNRNPU THAP11	Q00839 Q14247 Q96EK4 Q9UNZ5	0:0:0:0	hu.MAP
	CTTN PRRC2B PRRC2C	Q14247 Q5JSZ5 Q9Y520	0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	3	38113368 33304478 36146834

Sequence, Structure & Domains14

Sequences

Length

550

Mass

61,586

Sequence

MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q14247-1; Sequence=Displayed; Name=2; IsoId=Q14247-2; Sequence=VSP_043120, VSP_043121; Name=3; IsoId=Q14247-3; Sequence=VSP_043120

Alternative Sequence

264..300; Missing (in isoform 2 and isoform 3); 538..550; YGLFPANYVELRQ -> FRELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKDCPRRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWEICLCHTVTARRIRKLISFLRSREAGPVPSCSQVGGVSFQKVTWKCLGTWVPECP (in isoform 2)

3D Structural Models

Helix

543..545

Beta Strand

497..499; 506..510; 518..523; 526..534; 537..542; 546..548

3D Structure

NMR spectroscopy (4); X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

17..27; Acidic residues; 357..396; Basic and acidic residues

Repeat

80..116; Cortactin 1; 117..153; Cortactin 2; 154..190; Cortactin 3; 191..227; Cortactin 4; 228..264; Cortactin 5; 265..301; Cortactin 6; 302..324; Cortactin 7; truncated

Coiled Coil

348..401

Domain (CC)

The SH3 motif may mediate binding to the cytoskeleton.

Domain (FT)

492..550; SH3

Region

1..27; Disordered; 344..419; Disordered

Clinical Relevance6

Disease Involvement

Cancer-related genes

Drugs (2)

GSK2606414 GSK2656157

Antibody (2)

CAB011235 HPA057242

Interaction Protein (14)

ENSG00000094631ENSG00000111229ENSG00000113758ENSG00000115091ENSG00000126016ENSG00000136068ENSG00000136754ENSG00000138071ENSG00000146648ENSG00000153317ENSG00000159251ENSG00000163466ENSG00000196924ENSG00000198898

Interaction Count

14

Interaction Dataset (2)

intact_biogridbiogrid_opencell

Supporting Publications7

PMID	Title	Abstract
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No abstract available

Entry name SRC8	UniProt ID Q14247	EVMP confidence score 0.63
Supporting publications (n) 7	Transmembrane count	Protein classification Cancer-related genesPlasma proteinsPredicted intracellular proteins

SRC8