Protein detail
FLOT2
Flotillin-2 (Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1)
Protein symbol FLOT2 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Flotillin-2 (Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1)
Protein Class
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
ECS-1ECS1ESAESA1M17S1
Gene Description
Flotillin 2
Chromosome
17
Position
28879335-28897733
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificesophagusBrain Regional Specificchoroid plexusCell SpecificBasal keratinocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
- GO:0001931 uropod
- GO:0002080 acrosomal membrane
- GO:0005768 endosome
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0005912 adherens junction
- GO:0005925 focal adhesion
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0016600 flotillin complex
- GO:0030027 lamellipodium
- GO:0030139 endocytic vesicle
- GO:0030864 cortical actin cytoskeleton
- GO:0031410 cytoplasmic vesicle
- GO:0031982 vesicle
- GO:0032839 dendrite cytoplasm
- GO:0043231 intracellular membrane-bounded organelle
- GO:0044291 cell-cell contact zone
- GO:0048471 perinuclear region of cytoplasm
- GO:0070062 extracellular exosome
- GO:0098978 glutamatergic synapse
Molecular Function
Biological Process
Reactome
- R-hsa-112316 neuronal system
- R-hsa-5357801 programmed cell death
- R-hsa-6794362 protein protein interactions at synapses
- R-hsa-5218859 regulated necrosis
- R-hsa-8980692 rhoa gtpase cycle
- R-hsa-9013026 rhob gtpase cycle
- R-hsa-9013106 rhoc gtpase cycle
- R-hsa-9012999 rho gtpase cycle
- R-hsa-5213460 ripk1 mediated regulated necrosis
- R-hsa-9696273 rnd1 gtpase cycle
- R-hsa-9696264 rnd3 gtpase cycle
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-8849932 synaptic adhesion like molecules
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FLOT2 | ZDHHC5 | Q9C0B5 | C | 20 | palmitoylation | dbPTM | dbPTM:22081607 |
| FLOT2 | FYN | P06241 | Y | 163 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:19258392 |
Ligand-Receptor Signaling
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| flotillin | intracellular_intercellular_related | HGNC | No | Yes | No | No | No |
| intracellular_intercellular_related | intracellular_intercellular_related | OmniPath | Yes | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration | Mass spectrometry|Western blotting|FACSFACSMass spectrometry [LTQ-FT Ultra]Mass spectrometry | 1 | 38590132 |
Sequence, Structure & Domains
Sequences
Length
428
Mass
47,064
Sequence
MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
3D Structural Models
Domain & Motif Annotations
Protein Families
- Band 7/mec-2 family
- Flotillin subfamily
Sequence Similarities
Belongs to the band 7/mec-2 family. Flotillin subfamily.