Protein detail
FLOT2
Flotillin-2 (Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1)
Entry name FLOT2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Flotillin-2 (Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
ECS-1ECS1ESAESA1M17S1
Gene Description
Flotillin 2
Chromosome
17
Position
28879335-28897733
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificesophagusBrain Regional Specificchoroid plexusCell SpecificBasal keratinocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (21)
- GO:0001931 uropod
- GO:0002080 acrosomal membrane
- GO:0005768 endosome
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0005912 adherens junction
- GO:0005925 focal adhesion
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0016600 flotillin complex
Page 1 of 3
Molecular Function (2)
Biological Process (3)
Reactome (13)
- R-hsa-112316 neuronal system
- R-hsa-5357801 programmed cell death
- R-hsa-6794362 protein protein interactions at synapses
- R-hsa-5218859 regulated necrosis
- R-hsa-8980692 rhoa gtpase cycle
- R-hsa-9013026 rhob gtpase cycle
- R-hsa-9013106 rhoc gtpase cycle
- R-hsa-9012999 rho gtpase cycle
- R-hsa-5213460 ripk1 mediated regulated necrosis
- R-hsa-9696273 rnd1 gtpase cycle
Page 1 of 2
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence12
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FLOT2 | ZDHHC5 | Q9C0B5 | C | 20 | palmitoylation | dbPTM | dbPTM:22081607 |
| FLOT2 | FYN | P06241 | Y | 163 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:19258392 |
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| flotillin | intracellular_intercellular_related | HGNC | Yes | ||||
| intracellular_intercellular_related | intracellular_intercellular_related | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration | Mass spectrometry|Western blotting|FACSFACSMass spectrometry [LTQ-FT Ultra]Mass spectrometry | 1 | 38590132 |
Sequence, Structure & Domains
Sequences
Length
428
Mass
47,064
Sequence
MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
Domain & Motif Annotations
Protein Families (2)
- Band 7/mec-2 family
- Flotillin subfamily
Sequence Similarities
Belongs to the band 7/mec-2 family. Flotillin subfamily.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No related sentences available |