Protein detail

SEPT2

Septin-2 (Neural precursor cell expressed developmentally down-regulated protein 5) (NEDD-5)

Entry name SEPT2	UniProt ID Q15019	EVMP confidence score 0.38
Supporting publications (n) 4	Transmembrane count	Protein classification Cancer-related genesPlasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Septin-2 (Neural precursor cell expressed developmentally down-regulated protein 5) (NEDD-5)

Protein Class (3)

Cancer-related genesPlasma proteinsPredicted intracellular proteins

Protein Function (2)

Cancer-related genes:Candidate cancer biomarkers
Predicted intracellular proteins

Ensembl

ENSG00000168385

Entrez Gene Symbol

SEPTIN2

Gene Synonym (6)

DIFF6hNedd5KIAA0158NEDD5Pnutl3SEPT2

Gene Description

Septin 2

Chromosome

Position

241315100-241354027

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Cell SpecificCorticotrophsSingle-Nuclei Brain Specificoligodendrocyte

Function & Pathway7

Protein Function (2)

Cancer-related genes:Candidate cancer biomarkers
Predicted intracellular proteins

Cellular Component (22)

Page 1 of 3

Molecular Function (6)

Biological Process (3)

KEGG (2)

Reactome (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence29

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
SEPTIN2	CSNK2A1	P68400	S	218	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:16857012 SIGNOR:16857012

Ligand-Receptor Signaling (7)

7 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	GO_Intercell	No	Yes	No	No	No
receptor	receptor	OmniPath	No	Yes	No	No	No
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CSK21	P68400	SEPT2	Q15019	Yes	No	Yes	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:16857012 PhosphoSite:16857012 SIGNOR:16857012 PhosphoSite:15150837

Protein Complex Composition (19)

19 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
AURKB BRSK1 CDK1 PPP1CC SEPTIN1 SEPTIN11 SEPTIN14 SEPTIN2 SEPTIN6 SEPTIN7 SEPTIN9 UBC	P06493 P0CG48 P36873 Q14141 Q15019 Q16181 Q6ZU15 Q8TDC3 Q8WYJ6 Q96GD4 Q9NVA2 Q9UHD8	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9692
BRSK1 BRSK2 HSPA8 SEPTIN1 SEPTIN11 SEPTIN14 SEPTIN2 SEPTIN6 SEPTIN7 SEPTIN9 STMN1 TSSK6 UBC UHMK1	P0CG48 P11142 P16949 Q14141 Q15019 Q16181 Q6ZU15 Q8IWQ3 Q8TAS1 Q8TDC3 Q8WYJ6 Q9BXA6 Q9NVA2 Q9UHD8	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8161
BRSK1 BRSK2 PIAS4 SENP1 SEPTIN1 SEPTIN11 SEPTIN14 SEPTIN2 SEPTIN6 SEPTIN7 SEPTIN9 SUMO1 UBC	P0CG48 P63165 Q14141 Q15019 Q16181 Q6ZU15 Q8IWQ3 Q8N2W9 Q8TDC3 Q8WYJ6 Q9NVA2 Q9P0U3 Q9UHD8	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9572
PIAS3 SEPTIN1 SEPTIN11 SEPTIN14 SEPTIN2 SEPTIN5 SEPTIN6 SEPTIN7 SEPTIN9 SUMO2 UBE2I ZMIZ2	P61956 P63279 Q14141 Q15019 Q16181 Q6ZU15 Q8NF64 Q8WYJ6 Q99719 Q9NVA2 Q9UHD8 Q9Y6X2	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7875
SEPTIN10 SEPTIN11 SEPTIN2 SEPTIN6 SEPTIN7 SEPTIN8 SEPTIN9	Q14141 Q15019 Q16181 Q92599 Q9NVA2 Q9P0V9 Q9UHD8	0:0:0:0:0:0:0	hu.MAP2
SEPTIN2	Q15019	2	PDB	PDB:2qnrPDB:2qa5
CDKN2AIP PXDN SEPTIN12 SEPTIN2 XRN2	Q15019 Q8IYM1 Q92626 Q9H0D6 Q9NXV6	0:0:0:0:0	hu.MAP
SEPTIN2 SEPTIN8	Q15019 Q92599	1:1	PDB	PDB:6upr
SEPTIN11 SEPTIN2	Q15019 Q9NVA2	1:1	PDB	PDB:6upq

Page 2 of 2Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	23161513

Sequence, Structure & Domains13

Sequences

Length

361

Mass

41,487

Sequence

MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDGDGGALGHHV

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q15019-1; Sequence=Displayed; Name=2; IsoId=Q15019-2; Sequence=VSP_038271; Name=3; IsoId=Q15019-3; Sequence=VSP_055176

Alternative Sequence

1; M -> MPWISEGRATRPCLRVPSARRGDEGLHQRDEASQKM (in isoform 2); 72; A -> AALNTRKTLLW (in isoform 3)

3D Structural Models

Turn

103..107; 112..115; 172..174; 268..270

Helix

23..34; 50..58; 71..74; 116..134; 138..140; 162..171; 184..186; 189..205; 222..234; 273..293; 295..302

Beta Strand

37..44; 82..90; 93..101; 108..110; 148..153; 155..159; 177..181; 236..238; 245..247; 249..258; 261..264

3D Structure

Electron microscopy (1); X-ray crystallography (6)

Domain & Motif Annotations

Domain (FT)

34..306; Septin-type G

Region

44..51; G1 motif; 101..104; G3 motif; 182..185; G4 motif; 260..270; Important for dimerization

Protein Families (2)

TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily
Septin GTPase family

Sequence Similarities

Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.

Clinical Relevance5

Disease Involvement

Cancer-related genes

Antibody (3)

CAB017190 HPA018481 HPA063623

Interaction Protein (10)

ENSG00000044574ENSG00000100167ENSG00000105669ENSG00000122545ENSG00000125354ENSG00000138758ENSG00000164402ENSG00000184640ENSG00000184702ENSG00000186522

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid_opencell

Supporting Publications4

PMID	Title	Abstract
29603567	Involvement of serum-derived exosomes of elderly patients with bone loss in failure of bone remodeling via alteration of exosomal bone-related proteins.	No abstract available
31753726	Serum extracellular vesicles contain SPARC and LRG1 as biomarkers of colon cancer and differ by tumour primary location.	No abstract available
36028467	Plasma exosomal DOK3 reflects immunological states in lung tumor and predicts prognosis of gefitinib treatment.	No abstract available
38071653	Extracellular vesicle proteome unveils cathepsin B connection to Alzheimer's disease pathogenesis.	No abstract available