Protein detail
PLCB4
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-4) (Phospholipase C-beta-4) (PLC-beta-4)
Entry name PLCB4 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-4) (Phospholipase C-beta-4) (PLC-beta-4)
Protein Class (6)
Disease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteins
Protein Function (6)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Description
Phospholipase C beta 4
Chromosome
20
Position
9067825-9504593
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Function & Pathway
Protein Function (6)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Cellular Component (2)
Molecular Function (4)
Biological Process (3)
KEGG (63)
- hsa00562 Inositol phosphate metabolism
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04070 Phosphatidylinositol signaling system
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04081 Hormone signaling
Page 1 of 7
Reactome (7)
Canonical Pathways
M195 Pid cmyb pathway
Mediation Categories (3)
Fusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence8
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 18 | 247692332914823939569406356114623976615839940641363985643778691839409015348179062898658527894104337095104119761738321535351949653208974333709510 |
Sequence, Structure & Domains
Sequences
Length
1,175
Mass
134,464
Sequence
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSMMEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
Alternative Products
Event=Alternative splicing; Named isoforms=4; Comment=Additional isoforms seem to exist.; Name=2; IsoId=Q15147-1; Sequence=Displayed; Name=1; IsoId=Q15147-2; Sequence=VSP_004721, VSP_004722; Name=3; IsoId=Q15147-4; Sequence=VSP_037818; Name=4; IsoId=Q15147-5; Sequence=VSP_055182
Alternative Sequence
1..153; Missing (in isoform 1); 154..167; LAFMTNTNGKIPVR -> MNNNWNVCFFLFCP (in isoform 1); 535; V -> VKKASDDLEHENN (in isoform 4); 1154..1175; AKEMQQMVKLEAEMDRRPATVV -> LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN (in isoform 3)
Domain & Motif Annotations
Compositional Bias
493..508; Acidic residues; 881..895; Polar residues; 1085..1094; Polar residues; 1095..1109; Basic and acidic residues
Domain (FT)
313..463; PI-PLC X-box; 565..681; PI-PLC Y-box; 684..809; C2
Region
482..511; Disordered; 863..895; Disordered; 1082..1110; Disordered
Clinical Relevance
Disease Involvement
Disease variant
Antibody
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 31414377 | Global extracellular vesicle proteomic signature defines U87-MG glioma cell hypoxic status with potential implications for non-invasive diagnostics. | No related sentences available |