Protein detail
CYH1
Cytohesin-1 (PH, SEC7 and coiled-coil domain-containing protein 1) (SEC7 homolog B2-1)
Entry name CYH1 | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 0 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cytohesin-1 (PH, SEC7 and coiled-coil domain-containing protein 1) (SEC7 homolog B2-1)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
0
EVMP confidence score
0.47
Fluorescence & Localization
Cell SpecificFallopian tube ciliated cellsBlood Cell SpecificeosinophilBlood Lineage SpecificB-cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (7)
Molecular Function (3)
Biological Process (3)
KEGG (5)
Reactome (4)
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence31
Enzyme-Mediated Modification (14)
14 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CYTH1 | PRKCE | Q02156 | S | 394 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| CYTH1 | PRKCE | Q02156 | T | 395 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| CYTH1 | FYN | P06241 | Y | 382 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:23012656 |
| CYTH1 | SRC | P12931 | Y | 382 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:23012656 |
Page 2 of 2Previous
Ligand-Receptor Signaling (10)
10 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | |||
| tight_junction | tight_junction | Zhong2015 | Yes | Yes | |||
| tight_junction | tight_junction | OmniPath | Yes | Yes | |||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCD | Q05655 | CYH1 | Q15438 | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | ProtMapper:11438522HPRD-phos:11438522HPRD:11438522SIGNOR:11438522KEA:11438522 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CYTH1CYTH3CYTIP | O43739O60759Q15438 | 0:0:0 | hu.MAP2 | |||
| CYTH1CYTIP | O60759Q15438 | 0:0 | hu.MAP2 | |||
| CNDP2CSE1LCYTH1IDH3ASLC25A31UBC | P0CG48P50213P55060Q15438Q96KP4Q9H0C2 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4556 | ||
| AMFRCNDP2CSE1LCYTH1UBCUBE2G1 | P0CG48P55060P62253Q15438Q96KP4Q9UKV5 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC9444 | ||
| CYTH1 | Q15438 | 2 | PDB | PDB:4a4p |
Sequence, Structure & Domains
Sequences
Length
398
Mass
46,413
Sequence
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q15438-1; Sequence=Displayed; Name=2; IsoId=Q15438-2; Sequence=VSP_006034; Name=3; IsoId=Q15438-3; Sequence=VSP_055884
Alternative Sequence
1..59; Missing (in isoform 3); 273; Missing (in isoform 2)
3D Structural Models
Turn
137..139; 218..221
Helix
64..75; 77..86; 94..103; 109..116; 121..133; 141..150; 158..175; 183..201; 211..217; 229..241
Beta Strand
203..205; 246..248
3D Structure
NMR spectroscopy (1); X-ray crystallography (1)
Domain & Motif Annotations
Coiled Coil
10..67
Domain (CC)
Binds via its PH domain to the inositol head group of phosphatidylinositol 3,4,5-trisphosphate.; DOMAIN: Autoinhibited by its C-terminal basic region.
Domain (FT)
73..202; SEC7; 260..377; PH
Region
388..396; C-terminal autoinhibitory region
Clinical Relevance
Interaction Protein (5)
ENSG00000074706ENSG00000115165ENSG00000142675ENSG00000147144ENSG00000163362
Interaction Count
5
Interaction Dataset
intact_biogrid