Protein detail
LT4R1
Leukotriene B4 receptor 1 (LTB4-R 1) (LTB4-R1) (Chemoattractant receptor-like 1) (G-protein coupled receptor 16) (P2Y purinoceptor 7) (P2Y7)
Entry name LT4R1 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification Essential proteinsG-protein coupled receptorsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Leukotriene B4 receptor 1 (LTB4-R 1) (LTB4-R1) (Chemoattractant receptor-like 1) (G-protein coupled receptor 16) (P2Y purinoceptor 7) (P2Y7)
Protein Class (4)
Essential proteinsG-protein coupled receptorsPredicted membrane proteinsTransporters
Protein Function (3)
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- Transporters
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
20..42; Helical; Name=1; 55..75; Helical; Name=2; 92..113; Helical; Name=3; 139..159; Helical; Name=4; 179..199; Helical; Name=5; 222..242; Helical; Name=6; 269..289; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
BLTRCMKRL1GPR16LTB4R1P2RY7P2Y7
Gene Description
Leukotriene B4 receptor
Chromosome
14
Position
24311450-24318036
Supporting publications (n)
1
EVMP confidence score
0.28
Function & Pathway
Protein Function (3)
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- Transporters
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Molecular Function (4)
Biological Process (3)
Reactome (6)
Mediation Categories (2)
Clinical-translation mediationReceptor-signaling mediation
Relations & Evidence52
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| LTB4R | GRK6 | P43250 | T | 308 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | HPRD:20058876SIGNOR:12077128HPRD:12077128KEA:12077128phosphoELM:12077128ProtMapper:12077128 |
| LTB4R | GRK6 | P43250 | S | 310 | phosphorylation | PhosphoNetworks | |
| LTB4R | CSNK2A2 | P19784 | T | 308 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (42)
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | GO_Intercell | Yes | ||||
| transmembrane | transmembrane | CellPhoneDB | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes |
Regulatory Interaction Network (6)
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| GRK6 | P43250 | LT4R1 | Q15722 | Yes | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSiteHPRD-phos | PhosphoSite:12077128HPRD-phos:20058876PhosphoSite:30131369HPRD-phos:12077128PhosphoSite:22707565ProtMapper:20058876SIGNOR:12077128HPRD:12077128KEA:12077128phosphoELM:12077128ProtMapper:12077128 | |
| LT4R1 | Q15722 | GNAO | P09471 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| LT4R1 | Q15722 | GNA12 | Q03113 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| LT4R1 | Q15722 | GNAI1 | P63096 | Yes | Yes | HINTSIGNOR | SIGNOR:31160049HINT:35241677 | |
| LT4R1 | Q15722 | GNAI3 | P08754 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| LT4R1 | Q15722 | GNA14 | O95837 | Yes | Yes | SIGNOR | SIGNOR:31160049 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Small R sequencing (Illumi HiSeq 2000 (Solexa)Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
352
Mass
37,557
Sequence
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
3D Structural Models
Helix
14..44; 52..68; 71..80; 86..120; 122..128; 131..148; 152..155; 175..189; 191..208; 221..249; 260..277; 280..292; 294..296; 298..305
Beta Strand
156..160; 166..170; 257..259; 307..309
3D Structure
Electron microscopy (1); X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
310..326; Polar residues; 338..352; Polar residues
Region
310..352; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Related Diseases (13)
Biomarker
Terminated; Discontinued in Phase 2; Phase 2; Discontinued in Phase 1; Phase 1
Drugs (18)
Antibody
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No related sentences available |