Protein detail
AAAT
Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5)
Entry name AAAT | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 25 | Transmembrane count 8 | Protein classification FDA approved drug targetsMetabolic proteinsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5)
Protein Class (6)
FDA approved drug targetsMetabolic proteinsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- Transporters:Electrochemical Potential-driven transporters
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Transmembrane
52..81; Helical; Name=1; 95..116; Helical; Name=2; 131..153; Helical; Name=3; 225..248; Helical; Name=4; 258..285; Helical; Name=5; 307..328; Helical; Name=6; 374..400; Helical; Name=7; 461..482; Helical; Name=8
Transmembrane Count
8
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
AAATASCT2M7V1RDRC
Gene Description
Solute carrier family 1 member 5
Chromosome
19
Position
46774883-46788594
Supporting publications (n)
25
EVMP confidence score
0.75
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificInnate lymphoid cellsSingle-Nuclei Brain SpecificleukocyteBlood Cell SpecificgdT-cellBlood Lineage SpecificNK-cells
Function & Pathway
Protein Function (3)
- Transporters:Electrochemical Potential-driven transporters
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (12)
- GO:0001618 virus receptor activity
- GO:0005515 protein binding
- GO:0015171 amino acid transmembrane transporter activity
- GO:0015175 neutral L-amino acid transmembrane transporter activity
- GO:0015183 L-aspartate transmembrane transporter activity
- GO:0015186 L-glutamine transmembrane transporter activity
- GO:0015194 L-serine transmembrane transporter activity
- GO:0015293 symporter activity
- GO:0015297 antiporter activity
- GO:0022834 ligand-gated channel activity
Page 1 of 2
Biological Process (3)
Reactome (10)
- R-hsa-9013149 rac1 gtpase cycle
- R-hsa-9013423 rac3 gtpase cycle
- R-hsa-9013407 rhoh gtpase cycle
- R-hsa-9013409 rhoj gtpase cycle
- R-hsa-9013406 rhoq gtpase cycle
- R-hsa-9012999 rho gtpase cycle
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-9958863 slc mediated transport of amino acids
- R-hsa-382551 transport of small molecules
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence28
Ligand-Receptor Signaling (25)
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | CellPhoneDB | |||||
| transmembrane | transmembrane | TopDB | |||||
| transmembrane | transmembrane | LOCATE | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath | |||||
| peripheral | peripheral | UniProt_topology | |||||
| peripheral | peripheral | OmniPath |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryWestern blotting | 1 | 37886648 |
Sequence, Structure & Domains
Sequences
Length
541
Mass
56,598
Sequence
MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM
Alternative Products
Event=Alternative splicing, Alternative initiation; Named isoforms=3; Comment=A number of isoforms are produced by alternative initiation. Isoforms start at multiple alternative CUG and GUG codons.; Name=1; IsoId=Q15758-1; Sequence=Displayed; Name=2; IsoId=Q15758-2; Sequence=VSP_046354; Name=3; IsoId=Q15758-3; Sequence=VSP_046851
Alternative Sequence
1..228; Missing (in isoform 3); 1..203; MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRS -> M (in isoform 2)
3D Structural Models
Turn
169..173; 354..356; 432..435; 457..459
Helix
44..51; 53..74; 77..117; 121..153; 160..162; 165..168; 180..191; 196..199; 231..248; 249..252; 253..291; 295..318; 320..329; 333..339; 341..350; 357..368; 372..385; 388..404; 411..427; 436..445; 450..452; 453..456; 460..488
Beta Strand
157..159; 202..209; 214..216; 220..228
3D Structure
Electron microscopy (19); X-ray crystallography (4)
Domain & Motif Annotations
Domain (CC)
The transport domain consists of four transmembrane regions 3, 6, 7 and 8 and two helical hairpins HP1 and HP2. According to the one-gate elevator transport model, substrate binding and release is controlled by HP2 which acts as a gate for the transport domain. HP2 gate opening enables substrate binding or release. The gate closes once one amino acid and up to three sodium ions bind to the transport domain, which subsequently triggers transmembrane elevator-like motion of the transporter across the plasma membrane.; DOMAIN: The beta-hairpin (aa 204-224) located between the helical segments of TM4 protrudes in the extracellular space and forms a docking platform for proteins of retroviral origin.
Region
204..224; Beta-hairpin; 511..541; Disordered
Protein Families (2)
- Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family
- SLC1A5 subfamily
Sequence Similarities
Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A5 subfamily.
Clinical Relevance
Supporting Publications25
| PMID | Title | Related sentences |
|---|---|---|
| 23585444 | Identification and characterization of proteins isolated from microvesicles derived from human lung cancer pleural effusions. | No related sentences available |
| 24505114 | Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform. | These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4. |
| 24769233 | Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset. | Most interestingly, the involvement of extracellular vesicles in transferring toxic proteins such as α-synuclein and β-amyloid has been postulated as one of the mechanisms involved in the spreading of neurodegeneration to different brain areas. |
| 29242380 | Insights into the Proteome of Gastrointestinal Stromal Tumors-Derived Exosomes Reveals New Potential Diagnostic Biomarkers. | No related sentences available |
| 30451371 | Extracellular Vesicles from Neurosurgical Aspirates Identifies Chaperonin Containing TCP1 Subunit 6A as a Potential Glioblastoma Biomarker with Prognostic Significance. | No related sentences available |
| 30760538 | Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection. | No related sentences available |
| 30975894 | Use of extracellular vesicles from lymphatic drainage as surrogate markers of melanoma progression and BRAF V600E mutation. | No related sentences available |
| 31320591 | Exosomes regulate neurogenesis and circuit assembly. | No related sentences available |
| 31588238 | Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment. | No related sentences available |
| 32295833 | Dysregulation of Exosome Cargo by Mutant Tau Expressed in Human-induced Pluripotent Stem Cell (iPSC) Neurons Revealed by Proteomics Analyses. | Notably, mTau exosomes (not control exosomes) contain ANP32A (also known as I1PP2A), an endogenous inhibitor of the PP2A phosphatase which regulates the phosphorylation state of p-Tau. |
Page 1 of 3Next