Protein detail

ITSN1

Intersectin-1 (SH3 domain-containing protein 1A) (SH3P17)

Entry name ITSN1	UniProt ID Q15811	EVMP confidence score 0.50
Supporting publications (n) 5	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Intersectin-1 (SH3 domain-containing protein 1A) (SH3P17)

Protein Class (3)

Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000205726

Entrez Gene Symbol

ITSN1

Gene Synonym (5)

ITSNMGC134948MGC134949SH3D1ASH3P17

Gene Description

Intersectin 1

Chromosome

Position

33642400-33899861

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization6

Tissue Specificthyroid glandCell SpecificRenal collecting duct intercalated cellsSingle-Nuclei Brain Specificdeep-layer intratelencephalicBlood Cell Specificnaive B-cellBlood Lineage SpecificB-cells

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (10)

Molecular Function (5)

Biological Process (3)

Reactome (18)

Page 1 of 2

Canonical Pathways (2)

M177 Pid epha fwdpathway
M68 Pid rhoa reg pathway

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence29

Enzyme-Mediated Modification (6)

6 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
ITSN1	AKT1	P31749	S	315	phosphorylation	KEA	KEA:17570479
ITSN1	GSK3B	P49841	S	1,130	phosphorylation	KEA	KEA:17570479
ITSN1	MAPK10	P53779	S	897	phosphorylation	KEA	KEA:17570479
ITSN1	MAPK10	P53779	S	904	phosphorylation	KEA	KEA:17570479
ITSN1	MAPK9	P45984	S	1,130	phosphorylation	KEA	KEA:17570479
ITSN1	RPS6KA3	P51812	S	315	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (7)

7 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Regulatory Interaction Network (5)

5 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
EPHB2	P29323	ITSN1	Q15811	Yes	Yes	No	HPRDWangPhosphoPointSignaLink3	SignaLink3:23331499 HPRD:12389031 SignaLink3:12389031
ITSN1	Q15811	CDC42	P60953	Yes	Yes	No	WangSIGNORHPRDHINTSignaLink3SPIKE_LCLit-BM-17	SignaLink3:12006984 HPRD:12006984 SIGNOR:30540523 HINT:12006984 SIGNOR:15824104 SPIKE_LC:17145710 HPRD:11584276 SignaLink3:23331499 HINT:22403064 HPRD:15824104 SignaLink3:15824104 Lit-BM-17:11584276 Lit-BM-17:12006984 SignaLink3:11584276 HINT:11584276
GCC1	Q96CN9	ITSN1	Q15811	Yes	Yes	No	SIGNOR	SIGNOR:30540523
ITSN1	Q15811		COMPLEX:CHEBI:18348_O94973_P09496_P09497_P53675_P53680_P63010_Q00610_Q96CW1	Yes	Yes	No	SIGNOR	SIGNOR:24789820
	COMPLEX:O94973_P53680_P63010_Q96CW1	ITSN1	Q15811	Yes	Yes	No	SIGNOR	SIGNOR:15496985

Protein Complex Composition (10)

10 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CLIC1 CRELD2 ITSN1 LSM8	O00299 O95777 Q15811 Q6UXH1	0:0:0:0	hu.MAP
ATR BLM CCNO CDK1 ITSN1 MSH6 RAD1 RPA1 RPA2 TP53BP1 WRN	O60671 P06493 P15927 P22674 P27694 P52701 P54132 Q12888 Q13535 Q14191 Q15811	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7455
AGXT ALDH8A1 CAT CLYBL COL4A3 GCAT ITSN1 NAGA	O75600 P04040 P17050 P21549 Q01955 Q15811 Q8N0X4 Q9H2A2	0:0:0:0:0:0:0:0	hu.MAP2
CCNA2 CCNB1 CCNB2 CCNO CDC25C CDC27 CDK1 CDK2 CKS1B CKS2 FZR1 ITSN1 PKMYT1 PLK1 UBC	O95067 P06493 P0CG48 P14635 P20248 P22674 P24941 P30260 P30307 P33552 P53350 P61024 Q15811 Q99640 Q9UM11	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9182
CCNA2 CCNE1 CCNO CDK1 CDK2 CDK3 CKS1B CKS2 ITSN1 UBC WEE1	P06493 P0CG48 P20248 P22674 P24864 P24941 P30291 P33552 P61024 Q00526 Q15811	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9704
ITSN1 RAB9A SKIC3 TRIP13	P51151 Q15645 Q15811 Q6PGP7	0:0:0:0	Havugimana2012	Havugimana2012:C_204
CDC42 ITSN1	P60953 Q15811	2:2	PDB	PDB:3qbvPDB:5hzkPDB:1ki1
DNM1 HSPA14 ITSN1 MVB12B TSG101 VPS28 VPS37A VPS37B	Q05193 Q0VDF9 Q15811 Q8NEZ2 Q99816 Q9H7P6 Q9H9H4 Q9UK41	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4825
ITSN1 NDOR1 SETD3 SKIC2 SKIC3	Q15477 Q15811 Q6PGP7 Q86TU7 Q9UHB4	0:0:0:0:0	Havugimana2012	Havugimana2012:C_418
ITSN1	Q15811	2	PDB	PDB:6h5tPDB:5hziPDB:4iimPDB:5hzj

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	27894104

Sequence, Structure & Domains15

Sequences

Length

1,721

Mass

195,422

Sequence

MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGIASMPPLTAVAPVPMGSIPVVGMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTSSEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP

Alternative Products

Event=Alternative splicing; Named isoforms=13; Comment=Additional isoforms seem to exist. Alternative splicing affects domains involved in protein recognition and thus may play a role in selecting specific interactions.; Name=1; Synonyms=Long, ITSN-l; IsoId=Q15811-1; Sequence=Displayed; Name=2; Synonyms=Short, ITSN-s; IsoId=Q15811-2; Sequence=VSP_004295; Name=3; Synonyms=Short 2, SH3P17; IsoId=Q15811-3; Sequence=VSP_004293, VSP_004294, VSP_004295; Name=4; IsoId=Q15811-4; Sequence=VSP_004294; Name=5; Synonyms=ITSN1-22a; IsoId=Q15811-5; Sequence=VSP_004293, VSP_047460, VSP_047461; Name=6; Synonyms=Long form variant 4, Short form variant 11; IsoId=Q15811-6; Sequence=VSP_004293, VSP_053320, VSP_053321; Name=7; Synonyms=Short form variant 5; IsoId=Q15811-7; Sequence=VSP_004293, VSP_004295; Name=8; Synonyms=Long form variant 2; IsoId=Q15811-8; Sequence=VSP_004293; Name=9; Synonyms=Long form variant 3; IsoId=Q15811-9; Sequence=VSP_004293, VSP_053322; Name=10; Synonyms=Short form variant 2; IsoId=Q15811-10; Sequence=VSP_053317, VSP_004293, VSP_004295; Name=11; Synonyms=Short form variant 3; IsoId=Q15811-11; Sequence=VSP_053317, VSP_004294, VSP_004295; Name=12; Synonyms=Short form variant 10; IsoId=Q15811-12; Sequence=VSP_053317, VSP_004293, VSP_004294, VSP_004295; Name=13; Synonyms=Short form variant 14; IsoId=Q15811-13; Sequence=VSP_004293, VSP_053318, VSP_053319

Alternative Sequence

116..152; Missing (in isoform 10, isoform 11 and isoform 12); 770..774; Missing (in isoform 3, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 12 and isoform 13); 910..1025; GEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQ -> PDFLLHPSMRLGHMQPRIVLLFPDPLQCSTSRLLPMLRPRPGVPFLRSPSCQSPSHPSRPISDAAPSVKFTLMPPGRIHPCFLFIPAVNSRNSFLVYFILPGGTLGCFYLCLPHYL (in isoform 5); 910..919; GEKVEGLQAQ -> HGFWFFRESC (in isoform 13); 920..1721; Missing (in isoform 13); 1006..1076; Missing (in isoform 3, isoform 4, isoform 11 and isoform 12); 1006..1020; EFIAMYTYESSEQGD -> GLWNCWENREFRKKT (in isoform 6); 1021..1721; Missing (in isoform 6); 1026..1721; Missing (in isoform 5); 1221..1721; Missing (in isoform 2, isoform 3, isoform 7, isoform 10, isoform 11 and isoform 12); 1392..1447; Missing (in isoform 9)

3D Structural Models

Turn

12..14; 306..309

Helix

19..31; 41..48; 49..51; 55..65; 75..89; 100..102; 219..230; 242..250; 256..266; 276..290; 301..303; 798..800; 963..965; 1130..1132; 1233..1262; 1264..1269; 1275..1282; 1285..1306; 1316..1322; 1323..1327; 1328..1349; 1351..1361; 1364..1366; 1371..1374; 1377..1393; 1403..1437; 1522..1524; 1556..1577

Beta Strand

35..37; 38..40; 70..73; 215..217; 239..241; 272..275; 741..747; 766..769; 775..778; 780..782; 784..789; 792..797; 801..803; 916..922; 939..945; 947..954; 957..962; 966..969; 1078..1081; 1100..1106; 1110..1117; 1119..1121; 1125..1129; 1133..1136; 1271..1273; 1308..1310; 1444..1447; 1451..1454; 1456..1460; 1463..1466; 1472..1474; 1479..1493; 1511..1513; 1525..1528; 1531..1533; 1541..1544; 1547..1550

3D Structure

NMR spectroscopy (2); X-ray crystallography (9)

Domain & Motif Annotations

Compositional Bias

838..862; Polar residues

Motif

1104..1127; Bipartite nuclear localization signal; in isoform 2

Coiled Coil

355..659

Domain (CC)

SH3-3, SH3-4 and SH3-5, but not SH3-1 and SH3-2 domains, bind to dynamin (By similarity). SH3-1 and SH3-4 bind to ARHGAP31..; DOMAIN: The KLERQ domain binds to SNAP-25 and SNAP-23..; DOMAIN: In an autoinhibited form the SH3 domain 5 may bind intramolecularly to the DH domain, thus blocking the CDC42-binding site.

Domain (FT)

21..109; EH 1; 53..88; EF-hand 1; 221..310; EH 2; 254..289; EF-hand 2; 740..806; SH3 1; 913..971; SH3 2; 1002..1060; SH3 3; 1074..1138; SH3 4; 1155..1214; SH3 5; 1237..1423; DH; 1462..1571; PH; 1579..1695; C2

Region

322..348; Disordered; 326..702; KLERQ; 650..701; Disordered; 836..868; Disordered; 1074..1138; Required for interaction with FCHSD2

Clinical Relevance4

Antibody

HPA018007

Interaction Protein (15)

ENSG00000006125ENSG00000042753ENSG00000079805ENSG00000084463ENSG00000085832ENSG00000106976ENSG00000110395ENSG00000115904ENSG00000127527ENSG00000132639ENSG00000143013ENSG00000155980ENSG00000159082ENSG00000161203ENSG00000162946

Interaction Count

Interaction Dataset (3)

intact_biogridbiogrid_opencellintact_biogrid_opencell

Supporting Publications5

PMID	Title	Abstract
32916986	Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines.	No abstract available
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available
40985879	TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins.	No abstract available