Protein detail
ITSN1
Intersectin-1 (SH3 domain-containing protein 1A) (SH3P17)
Entry name ITSN1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 5 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Intersectin-1 (SH3 domain-containing protein 1A) (SH3P17)
Protein Class (3)
Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
ITSNMGC134948MGC134949SH3D1ASH3P17
Gene Description
Intersectin 1
Chromosome
21
Position
33642400-33899861
Supporting publications (n)
5
EVMP confidence score
0.50
Fluorescence & Localization6
Tissue Specificthyroid glandCell SpecificRenal collecting duct intercalated cellsSingle-Nuclei Brain Specificdeep-layer intratelencephalicBlood Cell Specificnaive B-cellBlood Lineage SpecificB-cells
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (10)
Molecular Function (5)
Biological Process (3)
Reactome (18)
- R-hsa-8856825 cargo recognition for clathrin mediated endocytosis
- R-hsa-9013148 cdc42 gtpase cycle
- R-hsa-204998 cell death signalling via nrage nrif and nade
- R-hsa-8856828 clathrin mediated endocytosis
- R-hsa-73887 death receptor signaling
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-2682334 eph ephrin signaling
- R-hsa-416482 g alpha 12 13 signalling events
- R-hsa-199991 membrane trafficking
- R-hsa-9675108 nervous system development
Page 1 of 2
Canonical Pathways (2)
- M177 Pid epha fwdpathway
- M68 Pid rhoa reg pathway
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence29
Enzyme-Mediated Modification (6)
6 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ITSN1 | AKT1 | P31749 | S | 315 | phosphorylation | KEA | KEA:17570479 |
| ITSN1 | GSK3B | P49841 | S | 1,130 | phosphorylation | KEA | KEA:17570479 |
| ITSN1 | MAPK10 | P53779 | S | 897 | phosphorylation | KEA | KEA:17570479 |
| ITSN1 | MAPK10 | P53779 | S | 904 | phosphorylation | KEA | KEA:17570479 |
| ITSN1 | MAPK9 | P45984 | S | 1,130 | phosphorylation | KEA | KEA:17570479 |
| ITSN1 | RPS6KA3 | P51812 | S | 315 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EPHB2 | P29323 | ITSN1 | Q15811 | Yes | Yes | No | HPRDWangPhosphoPointSignaLink3 | SignaLink3:23331499HPRD:12389031SignaLink3:12389031 |
| ITSN1 | Q15811 | CDC42 | P60953 | Yes | Yes | No | WangSIGNORHPRDHINTSignaLink3SPIKE_LCLit-BM-17 | SignaLink3:12006984HPRD:12006984SIGNOR:30540523HINT:12006984SIGNOR:15824104SPIKE_LC:17145710HPRD:11584276SignaLink3:23331499HINT:22403064HPRD:15824104SignaLink3:15824104Lit-BM-17:11584276Lit-BM-17:12006984SignaLink3:11584276HINT:11584276 |
| GCC1 | Q96CN9 | ITSN1 | Q15811 | Yes | Yes | No | SIGNOR | SIGNOR:30540523 |
| ITSN1 | Q15811 | COMPLEX:CHEBI:18348_O94973_P09496_P09497_P53675_P53680_P63010_Q00610_Q96CW1 | Yes | Yes | No | SIGNOR | SIGNOR:24789820 | |
| COMPLEX:O94973_P53680_P63010_Q96CW1 | ITSN1 | Q15811 | Yes | Yes | No | SIGNOR | SIGNOR:15496985 |
Protein Complex Composition (10)
10 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27894104 |
Sequence, Structure & Domains15
Sequences
Length
1,721
Mass
195,422
Sequence
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGIASMPPLTAVAPVPMGSIPVVGMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTSSEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Alternative Products
Event=Alternative splicing; Named isoforms=13; Comment=Additional isoforms seem to exist. Alternative splicing affects domains involved in protein recognition and thus may play a role in selecting specific interactions.; Name=1; Synonyms=Long, ITSN-l; IsoId=Q15811-1; Sequence=Displayed; Name=2; Synonyms=Short, ITSN-s; IsoId=Q15811-2; Sequence=VSP_004295; Name=3; Synonyms=Short 2, SH3P17; IsoId=Q15811-3; Sequence=VSP_004293, VSP_004294, VSP_004295; Name=4; IsoId=Q15811-4; Sequence=VSP_004294; Name=5; Synonyms=ITSN1-22a; IsoId=Q15811-5; Sequence=VSP_004293, VSP_047460, VSP_047461; Name=6; Synonyms=Long form variant 4, Short form variant 11; IsoId=Q15811-6; Sequence=VSP_004293, VSP_053320, VSP_053321; Name=7; Synonyms=Short form variant 5; IsoId=Q15811-7; Sequence=VSP_004293, VSP_004295; Name=8; Synonyms=Long form variant 2; IsoId=Q15811-8; Sequence=VSP_004293; Name=9; Synonyms=Long form variant 3; IsoId=Q15811-9; Sequence=VSP_004293, VSP_053322; Name=10; Synonyms=Short form variant 2; IsoId=Q15811-10; Sequence=VSP_053317, VSP_004293, VSP_004295; Name=11; Synonyms=Short form variant 3; IsoId=Q15811-11; Sequence=VSP_053317, VSP_004294, VSP_004295; Name=12; Synonyms=Short form variant 10; IsoId=Q15811-12; Sequence=VSP_053317, VSP_004293, VSP_004294, VSP_004295; Name=13; Synonyms=Short form variant 14; IsoId=Q15811-13; Sequence=VSP_004293, VSP_053318, VSP_053319
Alternative Sequence
116..152; Missing (in isoform 10, isoform 11 and isoform 12); 770..774; Missing (in isoform 3, isoform 5, isoform 6, isoform 7, isoform 8, isoform 9, isoform 10, isoform 12 and isoform 13); 910..1025; GEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQ -> PDFLLHPSMRLGHMQPRIVLLFPDPLQCSTSRLLPMLRPRPGVPFLRSPSCQSPSHPSRPISDAAPSVKFTLMPPGRIHPCFLFIPAVNSRNSFLVYFILPGGTLGCFYLCLPHYL (in isoform 5); 910..919; GEKVEGLQAQ -> HGFWFFRESC (in isoform 13); 920..1721; Missing (in isoform 13); 1006..1076; Missing (in isoform 3, isoform 4, isoform 11 and isoform 12); 1006..1020; EFIAMYTYESSEQGD -> GLWNCWENREFRKKT (in isoform 6); 1021..1721; Missing (in isoform 6); 1026..1721; Missing (in isoform 5); 1221..1721; Missing (in isoform 2, isoform 3, isoform 7, isoform 10, isoform 11 and isoform 12); 1392..1447; Missing (in isoform 9)
3D Structural Models
Turn
12..14; 306..309
Helix
19..31; 41..48; 49..51; 55..65; 75..89; 100..102; 219..230; 242..250; 256..266; 276..290; 301..303; 798..800; 963..965; 1130..1132; 1233..1262; 1264..1269; 1275..1282; 1285..1306; 1316..1322; 1323..1327; 1328..1349; 1351..1361; 1364..1366; 1371..1374; 1377..1393; 1403..1437; 1522..1524; 1556..1577
Beta Strand
35..37; 38..40; 70..73; 215..217; 239..241; 272..275; 741..747; 766..769; 775..778; 780..782; 784..789; 792..797; 801..803; 916..922; 939..945; 947..954; 957..962; 966..969; 1078..1081; 1100..1106; 1110..1117; 1119..1121; 1125..1129; 1133..1136; 1271..1273; 1308..1310; 1444..1447; 1451..1454; 1456..1460; 1463..1466; 1472..1474; 1479..1493; 1511..1513; 1525..1528; 1531..1533; 1541..1544; 1547..1550
3D Structure
NMR spectroscopy (2); X-ray crystallography (9)
Domain & Motif Annotations
Compositional Bias
838..862; Polar residues
Motif
1104..1127; Bipartite nuclear localization signal; in isoform 2
Coiled Coil
355..659
Domain (CC)
SH3-3, SH3-4 and SH3-5, but not SH3-1 and SH3-2 domains, bind to dynamin (By similarity). SH3-1 and SH3-4 bind to ARHGAP31..; DOMAIN: The KLERQ domain binds to SNAP-25 and SNAP-23..; DOMAIN: In an autoinhibited form the SH3 domain 5 may bind intramolecularly to the DH domain, thus blocking the CDC42-binding site.
Domain (FT)
21..109; EH 1; 53..88; EF-hand 1; 221..310; EH 2; 254..289; EF-hand 2; 740..806; SH3 1; 913..971; SH3 2; 1002..1060; SH3 3; 1074..1138; SH3 4; 1155..1214; SH3 5; 1237..1423; DH; 1462..1571; PH; 1579..1695; C2
Region
322..348; Disordered; 326..702; KLERQ; 650..701; Disordered; 836..868; Disordered; 1074..1138; Required for interaction with FCHSD2
Clinical Relevance4
Antibody
Interaction Protein (15)
ENSG00000006125ENSG00000042753ENSG00000079805ENSG00000084463ENSG00000085832ENSG00000106976ENSG00000110395ENSG00000115904ENSG00000127527ENSG00000132639ENSG00000143013ENSG00000155980ENSG00000159082ENSG00000161203ENSG00000162946
Interaction Count
15
Interaction Dataset (3)
intact_biogridbiogrid_opencellintact_biogrid_opencell
Supporting Publications5
| PMID | Title | Abstract |
|---|---|---|
| 32916986 | Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines. | No abstract available |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No abstract available |
| 40985879 | TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins. | No abstract available |