Protein detail
GRIK5
Glutamate receptor ionotropic, kainate 5 (GluK5) (Excitatory amino acid receptor 2) (EAA2) (Glutamate receptor KA-2) (KA2)
Entry name GRIK5 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 3 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Glutamate receptor ionotropic, kainate 5 (GluK5) (Excitatory amino acid receptor 2) (EAA2) (Glutamate receptor KA-2) (KA2)
Protein Function (2)
- Transporters:Transporter channels and pores
- FDA approved drug targets:Small molecule drugs
Transmembrane
545..565; Helical; 623..643; Helical; 804..824; Helical
Transmembrane Count
3
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway8
Protein Function (2)
- Transporters:Transporter channels and pores
- FDA approved drug targets:Small molecule drugs
Cellular Component (8)
Molecular Function (4)
- GO:0004970 glutamate-gated receptor activity
- GO:0015277 kainate selective glutamate receptor activity
- GO:0099507 ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
- GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Biological Process (3)
KEGG (3)
Reactome (5)
Canonical Pathways
M17 Pid notch pathway
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence37
Ligand-Receptor Signaling (35)
35 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| channels | transporter | Surfaceome | No | Yes | No | No | No |
| ion_channel | ion_channel | DGIdb | No | Yes | No | No | No |
| ion_channel | ion_channel | Almen2009 | No | Yes | No | No | No |
| ligand_gated | ion_channel | Almen2009 | No | Yes | No | No | No |
| ligand_gated | ion_channel | Surfaceome | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| ion_channel | ion_channel | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
Protein Complex Composition (1)
Sequence, Structure & Domains9
Sequences
Length
980
Mass
109,265
Sequence
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAKARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVGPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRGFLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGPALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKRKWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVSVCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAGSAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEATSPPRPRPGPAGPRELAEHE
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q16478-1; Sequence=Displayed; Name=2; IsoId=Q16478-2; Sequence=VSP_035585
Alternative Sequence
839..980; VSVCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAGSAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEATSPPRPRPGPAGPRELAEHE -> TPALHPAACQCSALGPRTPLKEPSMLLVKVPSTRVQVAFSRTSLRQVCPFLLQHQLSSLYWIQATNVQICCHFSSLKPSPDLTFPPSHRPLSSLLFTALAAVGGLPDASSFFFPPISSCPPLQSGIGPCHSTEATLVTSNFHV (in isoform 2)
Domain & Motif Annotations
Compositional Bias
894..903; Gly residues
Region
891..927; Disordered; 944..980; Disordered
Protein Families (2)
- Glutamate-gated ion channel (TC 1.A.10.1) family
- GRIK5 subfamily
Sequence Similarities
Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK5 subfamily.
Clinical Relevance1
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |
| 40784529 | Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine. | No abstract available |