Protein detail
OCLN
Occludin
Protein symbol OCLN | UniProt ID | EVMP score 0.63 |
Frequency 10 | Transmembrane count 4 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Occludin
Protein Class
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Transporters
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Potential drug targets
- Disease related genes
Transmembrane
67..89; Helical; 136..160; Helical; 171..195; Helical; 244..265; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym
PPP1R115
Gene Description
Occludin
Chromosome
5
Position
69492292-69558104
Frequency
10
EVMP Score
0.63
Fluorescence & Localization
Cell SpecificBrain inhibitory neurons
Function & Pathway
Protein Function
- Transporters
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Potential drug targets
- Disease related genes
Cellular Component
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0005923 bicellular tight junction
- GO:0016324 apical plasma membrane
- GO:0016327 apicolateral plasma membrane
- GO:0030054 cell junction
- GO:0030139 endocytic vesicle
- GO:0031252 cell leading edge
- GO:0031410 cytoplasmic vesicle
- GO:0032991 protein-containing complex
- GO:0070160 tight junction
Molecular Function
Biological Process
KEGG
Reactome
- R-hsa-109581 apoptosis
- R-hsa-111465 apoptotic cleavage of cellular proteins
- R-hsa-351906 apoptotic cleavage of cell adhesion proteins
- R-hsa-75153 apoptotic execution phase
- R-hsa-9758919 epithelial mesenchymal transition emt during gastrulation
- R-hsa-9758941 gastrulation
- R-hsa-5357801 programmed cell death
- R-hsa-73857 rna polymerase ii transcription
- R-hsa-8935964 runx1 regulates expression of components of tight junctions
- R-hsa-8878171 transcriptional regulation by runx1
Mediation Categories
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
37 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| OCLN | PRKCE | Q02156 | S | 340 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| OCLN | PRKCG | P05129 | S | 340 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | KEA:11502742ProtMapper:11502742SIGNOR:11502742 |
| OCLN | PRKCA | P17252 | S | 340 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | KEA:17570479KEA:11502742ProtMapper:11502742SIGNOR:11502742 |
| OCLN | CSNK2B | P67870 | T | 404 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | KEA:12804768ProtMapper:12804768SIGNOR:12804768 |
| OCLN | CSNK2B | P67870 | S | 408 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:12804768KEA:12804768ProtMapper:12804768SIGNOR:12804768HPRD:20166139 |
| OCLN | PRKCE | Q02156 | T | 438 | phosphorylation | SIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:21545357SIGNOR:21545357 |
| OCLN | PRKCE | Q02156 | T | 404 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:21545357SIGNOR:21545357 |
| OCLN | PRKCE | Q02156 | T | 424 | phosphorylation | SIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:21545357SIGNOR:21545357 |
| OCLN | PRKCE | Q02156 | T | 403 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| OCLN | PRKCB | P05771 | S | 340 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | KEA:11502742ProtMapper:11502742SIGNOR:11502742 |
Page 1 of 4Next
Ligand-Receptor Signaling
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| ligand | ligand | CellCall | Yes | No | No | No | No |
Regulatory Interaction Network
8 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | OCLN | Q16625 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperNetworKIN_KEA | KEA:17570479SIGNOR:11502742KEA:11502742ProtMapper:11502742HPRD:11502742 |
| CSK2B | P67870 | OCLN | Q16625 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD-phos:12804768HPRD:12804768KEA:12804768ProtMapper:12804768SIGNOR:12804768HPRD-phos:20166139 |
| KPCE | Q02156 | OCLN | Q16625 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:21545357SIGNOR:21545357 |
| KPCG | P05129 | OCLN | Q16625 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | HPRD:11502742KEA:11502742ProtMapper:11502742SIGNOR:11502742 |
| ITCH | Q96J02 | OCLN | Q16625 | Yes | No | Yes | HPRDSIGNORBioGRID | BioGRID:19478092HPRD:11782481SIGNOR:28542131 |
| KPCB | P05771 | OCLN | Q16625 | Yes | Yes | No | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11502742KEA:11502742PhosphoSite:21757728PhosphoSite:31073629PhosphoSite:22438576ProtMapper:11502742PhosphoSite:19125584PhosphoSite:27423695ProtMapper:22438576ProtMapper:34200613PhosphoSite:19478092HPRD:11502742PhosphoSite:31553086 |
| CSK21 | P68400 | OCLN | Q16625 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefiPTMnetProtMapperPhosphoSite_KEAKEAPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:21536752PhosphoSite:23758859PhosphoSite:21545357KEA:12804768PhosphoSite:19114660 |
| GRK6 | P43250 | OCLN | Q16625 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:27185880 |
Protein Complex Composition
0 records.
Sequence, Structure & Domains
Sequences
Length
522
Mass
59,144
Sequence
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; Synonyms=WT-OCLN, TM4(+); IsoId=Q16625-1; Sequence=Displayed; Name=2; Synonyms=OCLN-ex4del, TM4(-); IsoId=Q16625-2; Sequence=VSP_043877; Name=3; Synonyms=OCLN-ex7ext; IsoId=Q16625-3; Sequence=VSP_043879; Name=4; Synonyms=OCLN-ex3del, OCLN-ex3pdel; IsoId=Q16625-4; Sequence=VSP_043872; Name=5; Synonyms=OCLN-ex3-4del; IsoId=Q16625-5; Sequence=VSP_043872, VSP_043878; Name=6; Synonyms=OCLN-ex3p-9pdel; IsoId=Q16625-6; Sequence=VSP_043873, VSP_043875, VSP_043876; Name=7; Synonyms=OCLN-ex3p-7pdel; IsoId=Q16625-7; Sequence=VSP_043874, VSP_043876
Alternative Sequence
1..251; Missing (in isoform 4 and isoform 5); 50..69; DEILHFYKWTSPPGVIRILS -> ESLQAVKEQIVTHQEDGWRL (in isoform 6); 52..70; ILHFYKWTSPPGVIRILSM -> MTIEKKVKSTWLLLMNTID (in isoform 7); 70; Missing (in isoform 6); 71..522; Missing (in isoform 6 and isoform 7); 244..297; Missing (in isoform 2); 252..322; Missing (in isoform 5); 476..522; AAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT -> VNST (in isoform 3)
3D Structural Models
Turn
417..419
Helix
426..466; 472..488; 491..520
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
367..376; Polar residues; 381..390; Basic residues; 391..400; Basic and acidic residues
Coiled Coil
426..489
Domain (CC)
The C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction (By similarity). The first extracellular loop participates in an adhesive interaction.
Domain (FT)
60..269; MARVEL; 414..522; OCEL
Region
1..20; Disordered; 360..407; Disordered
Protein Families
ELL/occludin family
Sequence Similarities
Belongs to the ELL/occludin family.