Protein detail
OCLN
Occludin
Entry name OCLN | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 10 | Transmembrane count 4 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Occludin
Protein Class (6)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Transporters
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Potential drug targets
- Disease related genes
Transmembrane
67..89; Helical; 136..160; Helical; 171..195; Helical; 244..265; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym
PPP1R115
Gene Description
Occludin
Chromosome
5
Position
69492292-69558104
Supporting publications (n)
10
EVMP confidence score
0.63
Fluorescence & Localization2
Cell SpecificBrain inhibitory neurons
Function & Pathway7
Protein Function (5)
- Transporters
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Potential drug targets
- Disease related genes
Cellular Component (12)
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0005923 bicellular tight junction
- GO:0016324 apical plasma membrane
- GO:0016327 apicolateral plasma membrane
- GO:0030054 cell junction
- GO:0030139 endocytic vesicle
- GO:0031252 cell leading edge
- GO:0031410 cytoplasmic vesicle
Page 1 of 2
Molecular Function (2)
Biological Process (3)
KEGG (7)
Reactome (10)
- R-hsa-109581 apoptosis
- R-hsa-111465 apoptotic cleavage of cellular proteins
- R-hsa-351906 apoptotic cleavage of cell adhesion proteins
- R-hsa-75153 apoptotic execution phase
- R-hsa-9758919 epithelial mesenchymal transition emt during gastrulation
- R-hsa-9758941 gastrulation
- R-hsa-5357801 programmed cell death
- R-hsa-73857 rna polymerase ii transcription
- R-hsa-8935964 runx1 regulates expression of components of tight junctions
- R-hsa-8878171 transcriptional regulation by runx1
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence68
Enzyme-Mediated Modification (37)
37 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| OCLN | EDNRA | P25101 | T | 404 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:19114660 |
| OCLN | PMP22 | Q01453 | Y | 402 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:25377781 |
| OCLN | PMP22 | Q01453 | Y | 398 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:25377781 |
| OCLN | INSR | P06213 | S | 490 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:24398936 |
| OCLN | DSP | P15924 | S | 490 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:28331230 |
| OCLN | VEGFA | P15692 | S | 490 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:28331230 |
| OCLN | CSNK1E | P49674 | T | 404 | phosphorylation | KEA | KEA:17570479 |
Page 4 of 4Previous
Ligand-Receptor Signaling (22)
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| ligand | ligand | CellCall | Yes | No | No | No | No |
Regulatory Interaction Network (8)
8 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | OCLN | Q16625 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperNetworKIN_KEA | KEA:17570479SIGNOR:11502742KEA:11502742ProtMapper:11502742HPRD:11502742 |
| CSK2B | P67870 | OCLN | Q16625 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD-phos:12804768HPRD:12804768KEA:12804768ProtMapper:12804768SIGNOR:12804768HPRD-phos:20166139 |
| KPCE | Q02156 | OCLN | Q16625 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:21545357SIGNOR:21545357 |
| KPCG | P05129 | OCLN | Q16625 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | HPRD:11502742KEA:11502742ProtMapper:11502742SIGNOR:11502742 |
| ITCH | Q96J02 | OCLN | Q16625 | Yes | No | Yes | HPRDSIGNORBioGRID | BioGRID:19478092HPRD:11782481SIGNOR:28542131 |
| KPCB | P05771 | OCLN | Q16625 | Yes | Yes | No | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11502742KEA:11502742PhosphoSite:21757728PhosphoSite:31073629PhosphoSite:22438576ProtMapper:11502742PhosphoSite:19125584PhosphoSite:27423695ProtMapper:22438576ProtMapper:34200613PhosphoSite:19478092HPRD:11502742PhosphoSite:31553086 |
| CSK21 | P68400 | OCLN | Q16625 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefiPTMnetProtMapperPhosphoSite_KEAKEAPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:21536752PhosphoSite:23758859PhosphoSite:21545357KEA:12804768PhosphoSite:19114660 |
| GRK6 | P43250 | OCLN | Q16625 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:27185880 |
Sequence, Structure & Domains15
Sequences
Length
522
Mass
59,144
Sequence
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; Synonyms=WT-OCLN, TM4(+); IsoId=Q16625-1; Sequence=Displayed; Name=2; Synonyms=OCLN-ex4del, TM4(-); IsoId=Q16625-2; Sequence=VSP_043877; Name=3; Synonyms=OCLN-ex7ext; IsoId=Q16625-3; Sequence=VSP_043879; Name=4; Synonyms=OCLN-ex3del, OCLN-ex3pdel; IsoId=Q16625-4; Sequence=VSP_043872; Name=5; Synonyms=OCLN-ex3-4del; IsoId=Q16625-5; Sequence=VSP_043872, VSP_043878; Name=6; Synonyms=OCLN-ex3p-9pdel; IsoId=Q16625-6; Sequence=VSP_043873, VSP_043875, VSP_043876; Name=7; Synonyms=OCLN-ex3p-7pdel; IsoId=Q16625-7; Sequence=VSP_043874, VSP_043876
Alternative Sequence
1..251; Missing (in isoform 4 and isoform 5); 50..69; DEILHFYKWTSPPGVIRILS -> ESLQAVKEQIVTHQEDGWRL (in isoform 6); 52..70; ILHFYKWTSPPGVIRILSM -> MTIEKKVKSTWLLLMNTID (in isoform 7); 70; Missing (in isoform 6); 71..522; Missing (in isoform 6 and isoform 7); 244..297; Missing (in isoform 2); 252..322; Missing (in isoform 5); 476..522; AAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT -> VNST (in isoform 3)
3D Structural Models
Turn
417..419
Helix
426..466; 472..488; 491..520
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
367..376; Polar residues; 381..390; Basic residues; 391..400; Basic and acidic residues
Coiled Coil
426..489
Domain (CC)
The C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction (By similarity). The first extracellular loop participates in an adhesive interaction.
Domain (FT)
60..269; MARVEL; 414..522; OCEL
Region
1..20; Disordered; 360..407; Disordered
Protein Families
ELL/occludin family
Sequence Similarities
Belongs to the ELL/occludin family.
Clinical Relevance6
Supporting Publications10
| PMID | Title | Abstract |
|---|---|---|
| 33799461 | Proteomics Profiling of Neuron-Derived Small Extracellular Vesicles from Human Plasma: Enabling Single-Subject Analysis. | No abstract available |
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |
| 36573687 | Proteomic and phosphoproteomic landscape of salivary extracellular vesicles to assess OSCC therapeutical outcomes. | No abstract available |
| 38037300 | Proteomic profiling of paired human liver homogenate and tissue derived extracellular vesicles. | No abstract available |
| 38576002 | Therapy-induced senescent tumor cell-derived extracellular vesicles promote colorectal cancer progression through SERPINE1-mediated NF-κB p65 nuclear translocation. | No abstract available |
| 39408670 | Proteomic Characterization of Corneal Epithelial and Stromal Cell-Derived Extracellular Vesicles. | No abstract available |
| 39948040 | Quantitative proteomics identifies possible flow of metastatic cues between progressive stages of colorectal cancer via transfer of ceramide-dependent exosomal cargoes. | No abstract available |
| 39996590 | Surface Double Dendritic Magnetic Microfibrils for Rapid Isolation and Proteomic Profiling of Extracellular Vesicles from Microliters of Biofluids. | No abstract available |
| 40596376 | Proteomic profiling of plasma extracellular vesicles identifies signatures of innate immunity, coagulation, and endothelial activation in septic patients. | No abstract available |
| 40689422 | Defining the Ovarian Cancer Precancerous Landscape through Modeling Fallopian Tube Epithelium Reprogramming Driven by Extracellular Vesicles. | No abstract available |