Protein detail
AAK1
AP2-associated protein kinase 1 (EC 2.7.11.1) (Adaptor-associated kinase 1)
Entry name AAK1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 3 | Transmembrane count | Protein classification EnzymesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
AP2-associated protein kinase 1 (EC 2.7.11.1) (Adaptor-associated kinase 1)
Protein Class (2)
EnzymesPredicted intracellular proteins
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Kinases
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
DKFZp686K16132KIAA1048
Gene Description
AP2 associated kinase 1
Chromosome
2
Position
69457997-69674349
Supporting publications (n)
3
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway7
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Kinases
- Predicted intracellular proteins
Cellular Component (8)
Molecular Function (7)
Biological Process (3)
Reactome (4)
Canonical Pathways (3)
- M5887 Naba basement membranes
- M3008 Naba ecm glycoproteins
- M5884 Naba core matrisome
Mediation Categories (3)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediation
Relations & Evidence20
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| AAK1 | STK38 | Q15208 | S | 637 | phosphorylation | REACH_ProtMapperSIGNORProtMapper | ProtMapper:22445341SIGNOR:22445341 |
| AAK1 | CDK1 | P06493 | T | 389 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperKEAPhosphoSitePhosphoSite_ProtMapper | KEA:18691976 |
| AAK1 | CDK2 | P24941 | T | 640 | phosphorylation | KEA | KEA:17570479 |
| AAK1 | MAPK8 | P45983 | T | 640 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (8)
8 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AAK1 | Q2M2I8 | NUMB | P49757 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:18657069SIGNOR:18657069phosphoELM:18657069ProtMapper:18657069 |
| AAK1 | Q2M2I8 | AP1M1 | Q9BXS5 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperphosphoELMSIGNOR_ProtMapper | ProtMapper:11877461SIGNOR:11877461phosphoELM:11877461 |
| AAK1 | Q2M2I8 | AP2M1 | Q96CW1 | Yes | Yes | No | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperELMHINTphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | SIGNOR:11877461ProtMapper:34315807ProtMapper:31905947phosphoELM:11877457ELM:11877457ELM:34315807ELM:33137362ProtMapper:11877461phosphoELM:11877461HINT:25852190HINT:33961781 |
| COMPLEX:O94973_P53680_P63010_Q96CW1 | AAK1 | Q2M2I8 | Yes | Yes | No | SIGNOR | SIGNOR:15496985 | |
| STK38 | Q15208 | AAK1 | Q2M2I8 | Yes | Yes | No | iPTMnetSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapper | ProtMapper:22445341SIGNOR:22445341 |
Protein Complex Composition (2)
2 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| AAK1CIR1GEMIN2RNPS1SNRNP70SREK1SRSF1SRSF2U2AF1U2AF2ZRSR2 | O14893P08621P26368Q01081Q01130Q07955Q15287Q15696Q2M2I8Q86X95Q8WXA9 | 1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8432 | ||
| AAK1 | Q2M2I8 | 2 | PDB | PDB:4wsqPDB:5l4qPDB:8gmdPDB:9qb5PDB:8gmc |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration | Mass spectrometry | 1 | 32795414 |
Sequence, Structure & Domains14
Sequences
Length
961
Mass
103,885
Sequence
MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTTETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKPQAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPPAQQQPAGTFYQQQQAQTQQFQAVHPATQKPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQQQQQQQLATALHQQQLMTQQAALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQPKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAAAEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDDDNFSKLTAEELLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFIPLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPVPQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNLISGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLIDL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=AAK1L; IsoId=Q2M2I8-1; Sequence=Displayed; Name=2; Synonyms=AAK1S; IsoId=Q2M2I8-2; Sequence=VSP_039459
Alternative Sequence
823..961; EKADVAVESLIPGLEPPVPQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNLISGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLIDL -> GKVIISVSSVMHDMCACFKNDKYLVNQSLGNSPATPEAKAI (in isoform 2)
3D Structural Models
Turn
116..118; 142..144; 261..264; 298..300
Helix
31..34; 81..97; 134..139; 148..167; 179..181; 205..208; 210..220; 223..225; 228..231; 242..257; 266..271; 284..293; 304..315; 339..344
Beta Strand
38..41; 44..55; 58..64; 70..78; 106..113; 120..127; 168..170; 182..184; 190..192
3D Structure
X-ray crystallography (8)
Domain & Motif Annotations
Compositional Bias
1..11; Basic and acidic residues; 12..25; Gly residues; 417..427; Pro residues; 444..476; Low complexity; 483..493; Low complexity; 562..575; Low complexity; 576..588; Pro residues; 615..627; Polar residues; 672..696; Polar residues; 844..860; Polar residues; 931..944; Low complexity
Domain (FT)
46..315; Protein kinase
Region
1..25; Disordered; 327..493; Disordered; 562..632; Disordered; 664..701; Disordered; 823..960; Clathrin-binding domain (CBD); 836..860; Disordered; 921..945; Disordered
Protein Families (2)
- Protein kinase superfamily
- Ser/Thr protein kinase family
Sequence Similarities
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Clinical Relevance7
Related Diseases (3)
Biomarker
Phase 1; Phase 3; Approved
Drugs (6)
Interaction Protein (5)
ENSG00000006125ENSG00000017797ENSG00000042753ENSG00000060237ENSG00000159363
Interaction Count
5
Interaction Dataset (2)
biogrid_opencellintact_biogrid
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 33531104 | MicroRNA-135a in ABCA1-labeled Exosome is a Serum Biomarker Candidate for Alzheimer's Disease. | In the present study, the ABCA1 was used as a label to capture specific exosomes, the level of ABCA1-labeled exosomal microRNA-135a (miR-135a) was evaluated for the diagnosis of Alzheimer's disease (AD), especially in patients with early stages of AD. The level of ABCA1 exosomes harvested from HT-22 cells and neuron culture medium was significantly higher compared to that of RBCs and WBCs ( This study outlines a method to capture specific exosomes and detect them using immunological methods, which is more efficient for early diagnosis of AD. |
| 33763470 | ABCA1-Labeled Exosomes in Serum Contain Higher MicroRNA-193b Levels in Alzheimer's Disease. | We aimed to establish a method to determine whether microRNA-193b (miR-193b) levels in ABCA1-labeled serum exosomes might serve as a marker for the diagnosis of Alzheimer's disease. ABCA1-labeled exosomal miR-193b levels were also evaluated in the cerebrospinal fluid (CSF) and serum of APP/PS1 double-transgenic mice, as well as control subjects ( ABCA1 levels of exosomes harvested from the medium of HT-22 cells and neurons were significantly higher than those of RBCs and WBCs ( This study provides a method to capture specific exosomes. Detection of serum exosomes labeled with ABCA1 may facilitate the early diagnosis of AD. |
| 39016173 | HIV-1 Nef is carried on the surface of extracellular vesicles. | No abstract available |