Protein detail
SPRE3
Sprouty-related, EVH1 domain-containing protein 3 (Spred-3)
Protein symbol SPRE3 | UniProt ID | EVMP score 0.50 |
Frequency 2 | Transmembrane count | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Sprouty-related, EVH1 domain-containing protein 3 (Spred-3)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Frequency
2
EVMP Score
0.50
Fluorescence & Localization
Tissue Specificchoroid plexusBrain Regional Specificchoroid plexusCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
Reactome
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-6802957 oncogenic mapk signaling
- R-hsa-6802953 ras signaling downstream of nf1 loss of function variants
- R-hsa-5658442 regulation of ras by gaps
Canonical Pathways
- M142 Pid ajdiss 2pathway
- M100 Pid shp2 pathway
- M187 Pid trkr pathway
Mediation Categories
Clinical-translation mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Sequence, Structure & Domains
Sequences
Length
410
Mass
42,670
Sequence
MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKTTLECTLKPGLVYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTPSSSSSSSSPSQDTAETPCPLTSHVDSDSSSSHSRQETPPSAAAAPIITMESASGFGPTTPPQRRRSSAQSYPPLLPFTGIPEPSEPLAGAGGLGWGGRGYEDYRRSGPPAPLALSTCVVRFAKTGALRGAALGPPAALPAPLTEAAPPAPPARPPPGPGPSSAPAKASPEAEEAARCVHCRALFRRRADGRGGRCAEAPDPGRLLVRRLSCLWCAESLLYHCLSDAEGDFSDPCACEPGHPRPAARWAALAALSLAVPCLCCYAPLRACHWVAARCGCAGCGGRHEEAAR
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q2MJR0-1; Sequence=Displayed; Name=2; Synonyms=EVE-3; IsoId=Q2MJR0-2; Sequence=VSP_042949, VSP_042950
Alternative Sequence
142..152; SHVDSDSSSSH -> LSQYFRHMLCP (in isoform 2); 153..410; Missing (in isoform 2)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
120..130; Low complexity; 147..165; Low complexity; 267..281; Pro residues
Domain (FT)
1..113; WH1; 195..244; KBD; 296..407; SPR
Region
117..210; Disordered; 258..288; Disordered