Protein detail
ASTRB
Protein Aster-B (GRAM domain-containing protein 1B)
Entry name ASTRB | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Predicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Protein Aster-B (GRAM domain-containing protein 1B)
Protein Class (3)
Predicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (2)
- Transporters
- Predicted intracellular proteins
Transmembrane
623..643; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
KIAA1201LINC01059
Gene Description
GRAM domain containing 1B
Chromosome
11
Position
123358428-123627774
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization2
Tissue SpecificbrainCell SpecificEndometrial ciliated cells
Function & Pathway5
Protein Function (2)
- Transporters
- Predicted intracellular proteins
Cellular Component (4)
Molecular Function (4)
Biological Process (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence18
Ligand-Receptor Signaling (14)
14 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
Page 1 of 2Next
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration | Data-Dependent Acquisition LC-MS/MS | 1 | 32795414 |
Sequence, Structure & Domains9
Sequences
Length
738
Mass
85,400
Sequence
MKGFKLSCTASNSNRSTPACSPILRKRSRSPTPQNQDGDTMVEKGSDHSSDKSPSTPEQGVQRSCSSQSGRSGGKNSKKSQSWYNVLSPTYKQRNEDFRKLFKQLPDTERLIVDYSCALQRDILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTDSEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPKEKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSKLLLVISCVICFSLVLLVILNMMLFYKLWMLEYTTQTLTAWQGLRLQERLPQSQTEWAQLLESQQKYHDTELQKWREIIKSSVMLLDQMKDSLINLQNGIRSRDYTSESEEKRNRYH
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q3KR37-1; Sequence=Displayed; Name=2; IsoId=Q3KR37-2; Sequence=VSP_025470; Name=3; IsoId=Q3KR37-3; Sequence=VSP_025469, VSP_025471, VSP_025472; Name=4; IsoId=Q3KR37-4; Sequence=VSP_057573
Alternative Sequence
1..309; Missing (in isoform 3); 1..40; Missing (in isoform 2); 78; K -> KSHKRLSK (in isoform 4); 310..361; EGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPTELSDSSDTHDE -> MPTSSAVLLRVLSIPLLTVLILARDLSALGGCPWGPLPLRCHCLLPDPLFCA (in isoform 3); 631..634; Missing (in isoform 3)
Domain & Motif Annotations
Compositional Bias
8..19; Polar residues; 41..51; Basic and acidic residues; 59..70; Low complexity; 259..268; Polar residues; 281..295; Polar residues; 545..556; Basic and acidic residues
Domain (CC)
GRAM domain binds phosphatidylserine in the PM and mediates protein recruitment to endoplasmic reticulum-plasma membrane contact sites (EPCS) in response to excess cholesterol in the PM.; DOMAIN: VASt (VAD1 Analog of StAR-related lipid transfer) domain, also known as ASTER (Greek for star) domain is a sterol-binding domain.
Domain (FT)
96..163; GRAM; 372..543; VASt
Region
1..81; Disordered; 254..301; Disordered; 544..566; Disordered
Clinical Relevance5
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |