Protein detail
CC50B
Cell cycle control protein 50B (P4-ATPase flippase complex beta subunit TMEM30B) (Transmembrane protein 30B)
Entry name CC50B | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 20 | Transmembrane count 2 | Protein classification Predicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Cell cycle control protein 50B (P4-ATPase flippase complex beta subunit TMEM30B) (Transmembrane protein 30B)
Protein Class (2)
Predicted membrane proteinsTransporters
Protein Function
Transporters:Accessory Factors Involved in Transport
Transmembrane
34..54; Helical; 316..336; Helical
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym
CDC50B
Gene Description
Transmembrane protein 30B
Chromosome
14
Position
61277370-61281761
Supporting publications (n)
20
EVMP confidence score
0.47
Fluorescence & Localization5
Tissue Specificbone marrowCell SpecificNeutrophilsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway6
Protein Function
Transporters:Accessory Factors Involved in Transport
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence16
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 2 of 2Previous
Protein Complex Composition (2)
2 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ATP8A1-CDC50B P4-ATPase complex | ATP8A1TMEM30B | Q3MIR4Q9Y2Q0 | 1:1 | ComplexPortal | intact:EBI-26442804 | 30509129265673353141693114755292274583832531577320961850 |
| ATP8B4-CDC50B P4-ATPase complex | ATP8B4TMEM30B | Q3MIR4Q8TF62 | 1:1 | ComplexPortal | intact:EBI-26444220 | 305091292656733514755292274583832531577320961850 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration | Data-Dependent Acquisition LC-MS/MS | 1 | 32795414 |
Sequence, Structure & Domains9
Sequences
Length
351
Mass
38,941
Sequence
MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGDPGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGLPIAPCGAIANSLFNDSFSLWHQRQPGGPYVEVPLDRSGIAWWTDYHVKFRNPPLVNGSLALAFQGTAPPPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNPFLGIAYLVVGSLCILTGFVMLVVYIRYQDQDDDDEE
3D Structural Models
Turn
17..21; 137..141; 294..297
Helix
32..56; 76..79; 122..125; 130..134; 148..150; 164..167; 201..205; 217..219; 233..235; 248..254; 316..341
Beta Strand
87..89; 95..102; 108..116; 159..161; 174..181; 212..214; 236..238; 257..269; 280..287; 299..305
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Protein Families
CDC50/LEM3 family
Sequence Similarities
Belongs to the CDC50/LEM3 family.
Clinical Relevance1
Antibody
Supporting Publications20
| PMID | Title | Abstract |
|---|---|---|
| 24657793 | Plasma biomarker discovery in preeclampsia using a novel differential isolation technology for circulating extracellular vesicles. | No abstract available |
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No abstract available |
| 26884841 | Exosomes mediated pentose phosphate pathway in ovarian cancer metastasis: a proteomics analysis. | No abstract available |
| 30760538 | Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection. | No abstract available |
| 31196968 | Cancer Cell Derived Small Extracellular Vesicles Contribute to Recipient Cell Metastasis Through Promoting HGF/c-Met Pathway. | No abstract available |
| 31320591 | Exosomes regulate neurogenesis and circuit assembly. | No abstract available |
| 31508500 | Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping. | No abstract available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |
| 33718342 | Extracellular Vesicles Derived From Adult and Fetal Bone Marrow Mesenchymal Stromal Cells Differentially Promote ex vivo Expansion of Hematopoietic Stem and Progenitor Cells. | No abstract available |
| 34622320 | A possible role of gas-phase electrophoretic mobility molecular analysis (nES GEMMA) in extracellular vesicle research. | No abstract available |
Page 1 of 2Next