Protein detail
CC50B
Cell cycle control protein 50B (P4-ATPase flippase complex beta subunit TMEM30B) (Transmembrane protein 30B)
Entry name CC50B | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 20 | Transmembrane count 2 | Protein classification Predicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cell cycle control protein 50B (P4-ATPase flippase complex beta subunit TMEM30B) (Transmembrane protein 30B)
Protein Class (2)
Predicted membrane proteinsTransporters
Protein Function
Transporters:Accessory Factors Involved in Transport
Transmembrane
34..54; Helical; 316..336; Helical
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym
CDC50B
Gene Description
Transmembrane protein 30B
Chromosome
14
Position
61277370-61281761
Supporting publications (n)
20
EVMP confidence score
0.47
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificNeutrophilsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
Transporters:Accessory Factors Involved in Transport
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence16
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath | |||||
| tmem30_aminophospholipid_flippase | transporter | Almen2009 | Yes | ||||
| transporter | transporter | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | TopDB | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath |
Page 1 of 2Next
Protein Complex Composition (2)
2 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ATP8A1-CDC50B P4-ATPase complex | ATP8A1TMEM30B | Q3MIR4Q9Y2Q0 | 1:1 | ComplexPortal | intact:EBI-26442804 | 30509129265673353141693114755292274583832531577320961850 |
| ATP8B4-CDC50B P4-ATPase complex | ATP8B4TMEM30B | Q3MIR4Q8TF62 | 1:1 | ComplexPortal | intact:EBI-26444220 | 305091292656733514755292274583832531577320961850 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration | Data-Dependent Acquisition LC-MS/MS | 1 | 32795414 |
Sequence, Structure & Domains
Sequences
Length
351
Mass
38,941
Sequence
MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGDPGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGLPIAPCGAIANSLFNDSFSLWHQRQPGGPYVEVPLDRSGIAWWTDYHVKFRNPPLVNGSLALAFQGTAPPPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNPFLGIAYLVVGSLCILTGFVMLVVYIRYQDQDDDDEE
3D Structural Models
Turn
17..21; 137..141; 294..297
Helix
32..56; 76..79; 122..125; 130..134; 148..150; 164..167; 201..205; 217..219; 233..235; 248..254; 316..341
Beta Strand
87..89; 95..102; 108..116; 159..161; 174..181; 212..214; 236..238; 257..269; 280..287; 299..305
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Protein Families
CDC50/LEM3 family
Sequence Similarities
Belongs to the CDC50/LEM3 family.
Clinical Relevance
Antibody
Supporting Publications20
| PMID | Title | Related sentences |
|---|---|---|
| 36362114 | Extracellular Vesicles in Diffuse Large B Cell Lymphoma: Characterization and Diagnostic Potential. | No related sentences available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |
| 38490958 | Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |
| 39290459 | Urinary extracellular vesicles as a monitoring tool for renal damage in patients not meeting criteria for chronic kidney disease. | No related sentences available |
| 39873726 | Size-Dependent Separation of Extracellular Vesicle Subtypes with Exodisc Enabling Proteomic Analysis in Prostate Cancer. | No related sentences available |
| 39949490 | CRISPR-dCas9 Activation of TSG-6 in MSCs Modulates the Cargo of MSC-Derived Extracellular Vesicles and Attenuates Inflammatory Responses in Human Intervertebral Disc Cells In Vitro. | No related sentences available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No related sentences available |
| 40311616 | Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer. | No related sentences available |
| 40928027 | Familial Alzheimer's disease mutation identifies novel role of SORLA in release of neurotrophic exosomes. | No related sentences available |
Page 2 of 2Previous