Protein detail
FIL1L
Filamin A-interacting protein 1-like (130 kDa GPBP-interacting protein) (90 kDa GPBP-interacting protein) (Protein down-regulated in ovarian cancer 1) (DOC-1)
Entry name FIL1L | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 4 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Filamin A-interacting protein 1-like (130 kDa GPBP-interacting protein) (90 kDa GPBP-interacting protein) (Protein down-regulated in ovarian cancer 1) (DOC-1)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
DOC-1GIP130
Gene Description
Filamin A interacting protein 1 like
Chromosome
3
Position
99828811-100114513
Supporting publications (n)
4
EVMP confidence score
0.38
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence5
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FIL1L | Q4L180 | FLNC | Q14315 | Yes | No | Yes | SIGNOR | SIGNOR:32444788 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 27863537 |
Sequence, Structure & Domains10
Sequences
Length
1,135
Mass
130,382
Sequence
MRSRGSDTEGSAQKKFPRHTKGHSFQGPKNMKHRQQDKDSPSESDVILPCPKAEKPHSGNGHQAEDLSRDDLLFLLSILEGELQARDEVIGILKAEKMDLALLEAQYGFVTPKKVLEALQRDAFQAKSTPWQEDIYEKPMNELDKVVEKHKESYRRILGQLLVAEKSRRQTILELEEEKRKHKEYMEKSDEFICLLEQECERLKKLIDQEIKSQEEKEQEKEKRVTTLKEELTKLKSFALMVVDEQQRLTAQLTLQRQKIQELTTNAKETHTKLALAEARVQEEEQKATRLEKELQTQTTKFHQDQDTIMAKLTNEDSQNRQLQQKLAALSRQIDELEETNRSLRKAEEELQDIKEKISKGEYGNAGIMAEVEELRKRVLDMEGKDEELIKMEEQCRDLNKRLERETLQSKDFKLEVEKLSKRIMALEKLEDAFNKSKQECYSLKCNLEKERMTTKQLSQELESLKVRIKELEAIESRLEKTEFTLKEDLTKLKTLTVMFVDERKTMSEKLKKTEDKLQAASSQLQVEQNKVTTVTEKLIEETKRALKSKTDVEEKMYSVTKERDDLKNKLKAEEEKGNDLLSRVNMLKNRLQSLEAIEKDFLKNKLNQDSGKSTTALHQENNKIKELSQEVERLKLKLKDMKAIEDDLMKTEDEYETLERRYANERDKAQFLSKELEHVKMELAKYKLAEKTETSHEQWLFKRLQEEEAKSGHLSREVDALKEKIHEYMATEDLICHLQGDHSVLQKKLNQQENRNRDLGREIENLTKELERYRHFSKSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLYEESENQDEDPNDEGSVLSFKCSQSTPCPVNRKLWIPWMKSKEGHLQNGKMQTKPNANFVQPGDLVLSHTPGQPLHIKVTPDHVQNTATLEITSPTTESPHSYTSTAVIPNCGTPKQRITILQNASITPVKSKTSTEDLMNLEQGMSPITMATFARAQTPESCGSLTPERTMSPIQVLAVTGSASSPEQGRSPEPTEISAKHAIFRVSPDRQSSWQFQRSNSNSSSVITTEDNKIHIHLGSPYMQAVASPVRPASPSAPLQDNRTQGLINGALNKTTNKVTSSITITPTATPLPRQSQITVEPLLLPH
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; Synonyms=a, d; IsoId=Q4L180-1; Sequence=Displayed; Name=2; Synonyms=b, c; IsoId=Q4L180-2; Sequence=VSP_029206; Name=3; IsoId=Q4L180-3; Sequence=VSP_029201, VSP_029206; Name=4; IsoId=Q4L180-4; Sequence=VSP_029202, VSP_029203; Name=5; IsoId=Q4L180-5; Sequence=VSP_029201, VSP_029204, VSP_029205, VSP_029206; Name=6; IsoId=Q4L180-6; Sequence=VSP_036502; Name=7; IsoId=Q4L180-7; Sequence=VSP_029201
Alternative Sequence
1..424; Missing (in isoform 6); 1..240; Missing (in isoform 3, isoform 5 and isoform 7); 203..255; LKKLIDQEIKSQEEKEQEKEKRVTTLKEELTKLKSFALMVVDEQQRLTAQLTL -> WSLALLPRLECNGMILAHCNLCLLGSSDSPASAFQVAGITGTRHHAQLVFVFL (in isoform 4); 256..1135; Missing (in isoform 4); 373..386; Missing (in isoform 5); 1075..1080; Missing (in isoform 5); 1129..1135; EPLLLPH -> SNIYN (in isoform 2, isoform 3 and isoform 5)
Domain & Motif Annotations
Compositional Bias
52..65; Basic and acidic residues
Coiled Coil
164..782
Region
1..65; Disordered
Protein Families
FILIP1 family
Sequence Similarities
Belongs to the FILIP1 family.
Clinical Relevance1
Antibody
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33035814 | Knockout of PRDX6 induces mitochondrial dysfunction and cell cycle arrest at G2/M in HepG2 hepatocarcinoma cells. | No abstract available |
| 39940641 | Disease-Associated Signatures Persist in Extracellular Vesicles from Reprogrammed Cells of Osteoarthritis Patients. | No abstract available |