Protein detail

RIPL1

RILP-like protein 1 (Rab-interacting lysosomal-like protein 1)

Entry name RIPL1	UniProt ID Q5EBL4	EVMP confidence score 0.60
Supporting publications (n) 11	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

RILP-like protein 1 (Rab-interacting lysosomal-like protein 1)

Protein Class (3)

Disease related genesHuman disease related genesPredicted intracellular proteins

Protein Function (3)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Musculoskeletal diseases:Muscular diseases

Ensembl

ENSG00000188026

Entrez Gene Symbol

RILPL1

Gene Synonym

FLJ39378

Gene Description

Rab interacting lysosomal protein like 1

Chromosome

Position

123470054-123533719

Supporting publications (n)

EVMP confidence score

0.60

Fluorescence & Localization5

Tissue Specificparathyroid glandCell SpecificCytotrophoblastsSingle-Nuclei Brain SpecificoligodendrocyteBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells

Function & Pathway6

Protein Function (3)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Musculoskeletal diseases:Muscular diseases

Cellular Component (8)

Molecular Function (4)

Biological Process (3)

Canonical Pathways

M58 Pid ar pathway

Mediation Categories

Receptor-signaling mediation

Relations & Evidence6

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	GTF2E1 RILPL1 TTC39B UBC	P0CG48 P29083 Q5EBL4 Q5VTQ0	1:1:1:1	NetworkBlastCompleat	Compleat:HC5251

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	6	29148239 39989284 41216884 38321535 32089743 39940641

Sequence, Structure & Domains12

Sequences

Length

403

Mass

47,108

Sequence

MEEERGSALAAESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSPQPESGIKRLFSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q5EBL4-1; Sequence=Displayed; Name=2; IsoId=Q5EBL4-2; Sequence=VSP_027606, VSP_027608; Name=3; IsoId=Q5EBL4-3; Sequence=VSP_027605, VSP_027607

Alternative Sequence

1..151; Missing (in isoform 3); 1..24; Missing (in isoform 2); 152..153; HE -> MT (in isoform 3); 357..403; FSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL -> IFTAIMPMVAAGLIIDDPTLQPVRRLVSLV (in isoform 2)

3D Structural Models

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

262..275; Acidic residues; 394..403; Polar residues

Coiled Coil

76..258

Domain (FT)

10..97; RH1; 291..356; RH2

Region

254..275; Disordered; 327..352; Disordered; 384..403; Disordered

Protein Families

RILPL family

Sequence Similarities

Belongs to the RILPL family.

Clinical Relevance1

Antibody

HPA041314

Supporting Publications11

PMID	Title	Abstract
30451371	Extracellular Vesicles from Neurosurgical Aspirates Identifies Chaperonin Containing TCP1 Subunit 6A as a Potential Glioblastoma Biomarker with Prognostic Significance.	No abstract available
30760538	Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection.	No abstract available
32795414	Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers.	Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers.
33718342	Extracellular Vesicles Derived From Adult and Fetal Bone Marrow Mesenchymal Stromal Cells Differentially Promote ex vivo Expansion of Hematopoietic Stem and Progenitor Cells.	No abstract available
38490958	Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer.	No abstract available
38576002	Therapy-induced senescent tumor cell-derived extracellular vesicles promote colorectal cancer progression through SERPINE1-mediated NF-κB p65 nuclear translocation.	No abstract available
40091455	Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss.	No abstract available
40311616	Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer.	No abstract available
40545963	Extracellular Vesicle Proteome Analysis Improves Diagnosis of Recurrence in Triple-Negative Breast Cancer.	No abstract available
40784529	Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine.	No abstract available

Page 1 of 2Next