Protein detail
RIPL1
RILP-like protein 1 (Rab-interacting lysosomal-like protein 1)
Entry name RIPL1 | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 11 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
RILP-like protein 1 (Rab-interacting lysosomal-like protein 1)
Protein Class (3)
Disease related genesHuman disease related genesPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Musculoskeletal diseases:Muscular diseases
Ensembl
Entrez Gene Symbol
Gene Synonym
FLJ39378
Gene Description
Rab interacting lysosomal protein like 1
Chromosome
12
Position
123470054-123533719
Supporting publications (n)
11
EVMP confidence score
0.60
Fluorescence & Localization5
Tissue Specificparathyroid glandCell SpecificCytotrophoblastsSingle-Nuclei Brain SpecificoligodendrocyteBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells
Function & Pathway6
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Musculoskeletal diseases:Muscular diseases
Cellular Component (8)
Molecular Function (4)
Biological Process (3)
Canonical Pathways
M58 Pid ar pathway
Mediation Categories
Receptor-signaling mediation
Relations & Evidence6
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (1)
Sequence, Structure & Domains12
Sequences
Length
403
Mass
47,108
Sequence
MEEERGSALAAESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSPQPESGIKRLFSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q5EBL4-1; Sequence=Displayed; Name=2; IsoId=Q5EBL4-2; Sequence=VSP_027606, VSP_027608; Name=3; IsoId=Q5EBL4-3; Sequence=VSP_027605, VSP_027607
Alternative Sequence
1..151; Missing (in isoform 3); 1..24; Missing (in isoform 2); 152..153; HE -> MT (in isoform 3); 357..403; FSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL -> IFTAIMPMVAAGLIIDDPTLQPVRRLVSLV (in isoform 2)
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
262..275; Acidic residues; 394..403; Polar residues
Coiled Coil
76..258
Domain (FT)
10..97; RH1; 291..356; RH2
Region
254..275; Disordered; 327..352; Disordered; 384..403; Disordered
Protein Families
RILPL family
Sequence Similarities
Belongs to the RILPL family.
Clinical Relevance1
Antibody
Supporting Publications11
| PMID | Title | Abstract |
|---|---|---|
| 30451371 | Extracellular Vesicles from Neurosurgical Aspirates Identifies Chaperonin Containing TCP1 Subunit 6A as a Potential Glioblastoma Biomarker with Prognostic Significance. | No abstract available |
| 30760538 | Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33718342 | Extracellular Vesicles Derived From Adult and Fetal Bone Marrow Mesenchymal Stromal Cells Differentially Promote ex vivo Expansion of Hematopoietic Stem and Progenitor Cells. | No abstract available |
| 38490958 | Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer. | No abstract available |
| 38576002 | Therapy-induced senescent tumor cell-derived extracellular vesicles promote colorectal cancer progression through SERPINE1-mediated NF-κB p65 nuclear translocation. | No abstract available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No abstract available |
| 40311616 | Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer. | No abstract available |
| 40545963 | Extracellular Vesicle Proteome Analysis Improves Diagnosis of Recurrence in Triple-Negative Breast Cancer. | No abstract available |
| 40784529 | Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine. | No abstract available |
Page 1 of 2Next