Protein detail

PRRT3

Proline-rich transmembrane protein 3

Entry name PRRT3	UniProt ID Q5FWE3	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count 7	Protein classification Predicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Proline-rich transmembrane protein 3

Protein Class (2)

Predicted intracellular proteinsPredicted membrane proteins

Protein Function

Predicted intracellular proteins

Transmembrane

475..495; Helical; 502..522; Helical; 543..563; Helical; 571..591; Helical; 599..619; Helical; 639..659; Helical; 680..700; Helical

Transmembrane Count

Ensembl

ENSG00000163704

Entrez Gene Symbol

PRRT3

Gene Synonym

FLJ33674

Gene Description

Proline rich transmembrane protein 3

Chromosome

Position

9939450-9952408

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Tissue Specificskin 1Cell SpecificBasal keratinocytes

Function & Pathway4

Protein Function

Predicted intracellular proteins

Cellular Component

GO:0016020 membrane

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence11

Ligand-Receptor Signaling (10)

10 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane	transmembrane	UniProt_location	No	No	No	No	No
transmembrane	transmembrane	UniProt_topology	No	No	No	No	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
cell_surface	cell_surface	Surfaceome	No	No	No	No	No
cell_surface	cell_surface	OmniPath	No	No	No	No	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	No	No

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity CaptureMicrofluidics-Based Methods	Mass spectrometry	43	32795414 29148239 41216884 27863537 31196968 33035814 33718342 34622320 35611462 39949490 41315767 39766158 31508500 34108659 36398564 38225453 39873726 40545963 39409015 38644352 28986585 26801919 26884841 27723984 27894104 30071318 30608700 30646616 30950185 33709510 27312428 37686366 38321535 41201090 30760538 35194965 31320591 32089743 37922300 40311616 40091455 33114768 39940641

Sequence, Structure & Domains7

Sequences

Length

981

Mass

102,197

Sequence

MASSPWGCVCGLLLLLLPLLGTGPALGRGFPRPLENSEIPMIPGAHPKGSVGSEPQAFDVFPENPRADSHRNSDVRHAPAEEMPEKPVASPLGPALYGPKAAQGAQRERLPVTDDLQMAQGPSSHGWTGPLDSQELLQQEAVAPHPVGHPHLTFIPTTPRRQLRVATVPPSLQHEGQEGQWPPRDEGLKAKTKSRVPPTSPSDHQGPPHTLVSHSGTVKRPVLEGQGGFEEHLQEAAQGPHFTQQDPAAPDVGSVPPVEVVYSQEPGAQPDLALARSLPPAEELPVETPKRAGAEVSWEVSSPGPPPKQADLPDAKDSPGPQPTDPPASEAPDRPSKPERAAMNGADPISPQRVRGAVEAPGTPKSLIPGPSDPGPAVNRTESPMGALQPDEAEEWPGRPQSHPPAPPVQAPSTSRRGLIRVTTQRALGQPPPPEPTASSMASAPASSPPANATAPPLRWGPLRRVLSFSWELHVYGVGVLFLLPALLALAALAAAPAGPRLALVAAVLVLVASALRSAYMLTDPYGSQARLGVRGGLVLYNLPFPLLLTALAALTLLGLGAGLPPPLQNPLLLGAVALVHGVGLLATDLLSTWSVLNLLTQGLSCAWGAAVALGTLCLCRRRLLDGPRGWDASPGPRLLAVAGALGLLASGLQLAAALWLYPGPGRVGRFSWAWWGVHFWLRLLELTWALALALAAVAAARPRPPTEHACWAKLMRLACPAPSGKSEVPERPNNCYAGPSNVGAGSLDISKSLIRNPAESGQLATPSSGAWGSAASLGRGPQGGPGLSRNGVGPAPSLSELDLRPPSPINLSRSIDAALFREHLVRDSVFQRCGLRGLASPPPGGALRPRRGSHPKAELDDAGSSLLRGRCRSLSDVRVRGPVPQHVVEAPDGAAAAASGSSLDSFSRGSLKISWNPWRHGLSSVDSLPLDELPSTVQLLPAPTPAPDSTAARQGDGQGEVQPRGKPGESRSASSDTIEL

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q5FWE3-1; Sequence=Displayed; Name=2; IsoId=Q5FWE3-2; Sequence=VSP_020845; Name=3; IsoId=Q5FWE3-3; Sequence=VSP_020846, VSP_020847

Alternative Sequence

1..384; Missing (in isoform 2); 391..421; DEAEEWPGRPQSHPPAPPVQAPSTSRRGLIR -> GESMAGVWGEGVLCLVTENLCWGCMGAEGGE (in isoform 3); 422..981; Missing (in isoform 3)

Domain & Motif Annotations

Compositional Bias

65..85; Basic and acidic residues; 331..340; Basic and acidic residues; 411..427; Polar residues; 437..457; Low complexity; 765..780; Low complexity; 972..981; Polar residues

Region

43..107; Disordered; 169..457; Disordered; 297..302; O-glycosylated at one site; 759..807; Disordered; 836..865; Disordered; 937..981; Disordered

Clinical Relevance1

Antibody (3)

HPA035127 HPA035128 HPA069859

Supporting Publications2

PMID	Title	Abstract
25471207	Intraluminal proteome and peptidome of human urinary extracellular vesicles.	No abstract available
40098346	Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.	No abstract available