Protein detail
CL12A
C-type lectin domain family 12 member A (C-type lectin-like molecule 1) (CLL-1) (Dendritic cell-associated lectin 2) (DCAL-2) (Killer cell C-type lectin-like receptor L1) (hKLRL1) (Myeloid inhibitory C-type lectin-like receptor) (MICL) (CD antigen CD371)
Entry name CL12A | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification CD markersPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
C-type lectin domain family 12 member A (C-type lectin-like molecule 1) (CLL-1) (Dendritic cell-associated lectin 2) (DCAL-2) (Killer cell C-type lectin-like receptor L1) (hKLRL1) (Myeloid inhibitory C-type lectin-like receptor) (MICL) (CD antigen CD371)
Protein Class (4)
CD markersPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- Transporters:Transporter channels and pores
- CD markers
- Predicted intracellular proteins
Transmembrane
44..64; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CD371CLL-1DCAL-2MICL
Gene Description
C-type lectin domain family 12 member A
Chromosome
12
Position
9951316-9995694
Supporting publications (n)
2
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificadrenal glandCell SpecificAdrenal cortex cellsSingle-Nuclei Brain Specificendothelial cellBlood Cell Specificplasmacytoid DCBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function (3)
- Transporters:Transporter channels and pores
- CD markers
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (4)
Biological Process (3)
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence43
Ligand-Receptor Signaling (39)
39 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_predicted | transmembrane | OmniPath | Yes | ||||
| transmembrane | transmembrane | GO_Intercell | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes |
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometryWestern blottingR SequencingFlow cytometryELISA | 12 | 392904593887173034817906327954143873186825471207300713182210607137686366383215353849095840098346 |
Sequence, Structure & Domains
Sequences
Length
265
Mass
30,762
Sequence
MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKIEMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPDLNNMYCGYINRLYVQYYHCTYKKRMICEKMANPVQLGSTYFREA
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=2; Synonyms=Alpha; IsoId=Q5QGZ9-2; Sequence=Displayed; Name=1; IsoId=Q5QGZ9-1; Sequence=VSP_039854; Name=3; Synonyms=Gamma; IsoId=Q5QGZ9-3; Sequence=VSP_030031, VSP_030032; Name=4; Synonyms=Beta; IsoId=Q5QGZ9-4; Sequence=VSP_030030; Name=5; IsoId=Q5QGZ9-5; Sequence=VSP_030033
Alternative Sequence
1; M -> MWIDFFTYSSM (in isoform 1); 31..64; APPAPSHVWRPAALFLTLLCLLLLIGLGVLASMF -> V (in isoform 4); 64..81; FHVTLKIEMKKMNKLQNI -> CMYCPCFGQEEVSRISNI (in isoform 3); 82..265; Missing (in isoform 3); 214..265; Missing (in isoform 5)
3D Structural Models
Helix
101..124; 154..163; 174..183; 205..207; 212..214; 222..224
Beta Strand
138..140; 143..147; 186..190; 196..198; 225..231; 234..239; 244..251
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Motif
5..10; ITIM motif
Domain (CC)
The immunoreceptor tyrosine-based inhibitor motif (ITIM) is involved in modulation of cellular responses (PubMed:14739280). The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing protein phosphatases, such as PTPN6 and PTPN11 (PubMed:14739280).
Domain (FT)
140..249; C-type lectin
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No related sentences available |
| 39505756 | Differential proteomic profiles of exosomes in pediatric and adult adamantinomatous craniopharyngioma cyst fluid. | No related sentences available |