Protein detail
IFFO2
Intermediate filament family orphan 2
Entry name IFFO2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Intermediate filament family orphan 2
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
Intermediate filament family orphan 2
Chromosome
1
Position
18904280-18956676
Supporting publications (n)
2
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecifictongueCell SpecificBreast lactating cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence10
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| APTXIFFO1IFFO2LIG4LONRF2XRCC4 | P49917Q0D2I5Q13426Q1L5Z9Q5TF58Q7Z2E3 | 0:0:0:0:0:0 | hu.MAP | |||
| IFFO1IFFO2LIG4XRCC4 | P49917Q0D2I5Q13426Q5TF58 | 0:0:0:0 | hu.MAP | |||
| APTXIFFO1IFFO2LIG4XRCC4 | P49917Q0D2I5Q13426Q5TF58Q7Z2E3 | 0:0:0:0:0 | hu.MAP2 | |||
| APTXBADIFFO1IFFO2LIG4XRCC4 | P49917Q0D2I5Q13426Q5TF58Q7Z2E3Q92934 | 0:0:0:0:0:0 | hu.MAP2 | |||
| IFFO1IFFO2LONRF2XRCC4 | Q0D2I5Q13426Q1L5Z9Q5TF58 | 0:0:0:0 | hu.MAP | |||
| APTXIFFO1IFFO2XRCC4 | Q0D2I5Q13426Q5TF58Q7Z2E3 | 0:0:0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry | 21 | 401894973820710636064647381133684046519537322475364971843406467726826536313825373859013232854315409858793091508432560723413079683330982640840701318059583871651239207047 |
Sequence, Structure & Domains
Sequences
Length
517
Mass
57,328
Sequence
MVNSLLFGEMALAFGCPPGGGGGGCPGGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGLNVRFRCFLAKVHELERRNRLLEKQLEQQQSERERRLRYKTFSREQAVQTGPELLRPPAPGGGHGLSSGAAAGANANAVALGGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEELAKRMNLQTMVDTLQEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNRFSDDEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQDEFEREADVEPMVS
Domain & Motif Annotations
Compositional Bias
485..497; Low complexity; 501..517; Acidic residues
Domain (FT)
53..484; IF rod
Region
104..129; Disordered; 330..349; Disordered; 478..517; Disordered
Protein Families
Intermediate filament family
Sequence Similarities
Belongs to the intermediate filament family.
Clinical Relevance
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 17949417 | Different types of in vitro generated human monocyte-derived dendritic cells release exosomes with distinct phenotypes. | In comparison to exosomes from conventional MDDCs, exosomes from IL-4/IL-3-generated MDDCs showed significantly stronger signals for HLA-ABC, HLA-DR, CD11c, CD63 and CD81. |
| 38902710 | Exosomes multiplex profiling, a promising strategy for early diagnosis of laryngeal cancer. | Circulating exosomes were collected from serum collected from 30 LCa patients and 20 healthy volunteers by the use of antibody affinity method exploiting CD63 specific surface marker. |