Protein detail

IFFO2

Intermediate filament family orphan 2

Entry name IFFO2	UniProt ID Q5TF58	EVMP confidence score 0.38
Supporting publications (n) 2	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information10

Protein Names

Intermediate filament family orphan 2

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000169991

Entrez Gene Symbol

IFFO2

Gene Description

Intermediate filament family orphan 2

Chromosome

Position

18904280-18956676

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization3

Tissue SpecifictongueCell SpecificBreast lactating cells

Function & Pathway4

Protein Function

Predicted intracellular proteins

Cellular Component

GO:0005882 intermediate filament

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence10

Ligand-Receptor Signaling (3)

3 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (6)

6 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
APTX IFFO1 IFFO2 LIG4 LONRF2 XRCC4	P49917 Q0D2I5 Q13426 Q1L5Z9 Q5TF58 Q7Z2E3	0:0:0:0:0:0	hu.MAP
IFFO1 IFFO2 LIG4 XRCC4	P49917 Q0D2I5 Q13426 Q5TF58	0:0:0:0	hu.MAP
APTX IFFO1 IFFO2 LIG4 XRCC4	P49917 Q0D2I5 Q13426 Q5TF58 Q7Z2E3	0:0:0:0:0	hu.MAP2
APTX BAD IFFO1 IFFO2 LIG4 XRCC4	P49917 Q0D2I5 Q13426 Q5TF58 Q7Z2E3 Q92934	0:0:0:0:0:0	hu.MAP2
IFFO1 IFFO2 LONRF2 XRCC4	Q0D2I5 Q13426 Q1L5Z9 Q5TF58	0:0:0:0	hu.MAP
APTX IFFO1 IFFO2 XRCC4	Q0D2I5 Q13426 Q5TF58 Q7Z2E3	0:0:0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	21	40189497 38207106 36064647 38113368 40465195 37322475 36497184 34064677 26826536 31382537 38590132 32854315 40985879 30915084 32560723 41307968 33309826 40840701 31805958 38716512 39207047

Sequence, Structure & Domains8

Sequences

Length

517

Mass

57,328

Sequence

MVNSLLFGEMALAFGCPPGGGGGGCPGGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGLNVRFRCFLAKVHELERRNRLLEKQLEQQQSERERRLRYKTFSREQAVQTGPELLRPPAPGGGHGLSSGAAAGANANAVALGGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEELAKRMNLQTMVDTLQEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNRFSDDEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQDEFEREADVEPMVS

Domain & Motif Annotations

Compositional Bias

485..497; Low complexity; 501..517; Acidic residues

Domain (FT)

53..484; IF rod

Region

104..129; Disordered; 330..349; Disordered; 478..517; Disordered

Protein Families

Intermediate filament family

Sequence Similarities

Belongs to the intermediate filament family.

Clinical Relevance4

Antibody (2)

HPA015987 HPA064603

Interaction Protein (2)

ENSG00000088986ENSG00000264364

Interaction Count

Interaction Dataset

biogrid_opencell

Supporting Publications2

PMID	Title	Abstract
17949417	Different types of in vitro generated human monocyte-derived dendritic cells release exosomes with distinct phenotypes.	In comparison to exosomes from conventional MDDCs, exosomes from IL-4/IL-3-generated MDDCs showed significantly stronger signals for HLA-ABC, HLA-DR, CD11c, CD63 and CD81.
38902710	Exosomes multiplex profiling, a promising strategy for early diagnosis of laryngeal cancer.	Circulating exosomes were collected from serum collected from 30 LCa patients and 20 healthy volunteers by the use of antibody affinity method exploiting CD63 specific surface marker.