Protein detail
MRCKA
Serine/threonine-protein kinase MRCK alpha (EC 2.7.11.1) (CDC42-binding protein kinase alpha) (DMPK-like alpha) (Myotonic dystrophy kinase-related CDC42-binding kinase alpha) (MRCK alpha) (Myotonic dystrophy protein kinase-like alpha)
Entry name MRCKA | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 2 | Transmembrane count | Protein classification EnzymesPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Serine/threonine-protein kinase MRCK alpha (EC 2.7.11.1) (CDC42-binding protein kinase alpha) (DMPK-like alpha) (Myotonic dystrophy kinase-related CDC42-binding kinase alpha) (MRCK alpha) (Myotonic dystrophy protein kinase-like alpha)
Protein Class (2)
EnzymesPredicted intracellular proteins
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Kinases:AGC Ser/Thr protein kinases
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
FLJ23347KIAA0451MRCKMRCKAPK428
Gene Description
CDC42 binding protein kinase alpha
Chromosome
1
Position
226989865-227318492
Supporting publications (n)
2
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificheart muscleCell SpecificCardiomyocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Kinases:AGC Ser/Thr protein kinases
- Predicted intracellular proteins
Cellular Component (8)
Molecular Function (7)
Biological Process (3)
Reactome (6)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence19
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CDC42BPA | CDC42 | P60953 | T | 240 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15882626 |
| CDC42BPA | CDC42 | P60953 | S | 234 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15882626 |
| CDC42BPA | CDC42 | P60953 | S | 222 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15882626 |
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Regulatory Interaction Network (6)
6 records.
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Mob2p/Cbk1p complex | CDC42BPACDC42BPGMOB2STK38STK38L | Q15208Q5VT25Q6DT37Q70IA6Q9Y2H1 | 1:1:1:1:1 | Compleat | Compleat:HC169 | 12196508 |
| CDC42BPAMYL2MYL9MYO18APPIAPPP1R12C | P10916P24844P62937Q5VT25Q92614Q9BZL4 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5301 | ||
| CDC42BPALURAP1L | Q5VT25Q8IV03 | 0:0 | hu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
1,732
Mass
197,307
Sequence
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFERSPSCTPASKGRRTVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVISQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSGKVRHGALTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGNPYSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNNEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSDAPARDFDGEDSDSPRHSTASNSSNLSSPPSPASPRKTKSLSLESTDRGSWDP
Alternative Products
Event=Alternative splicing; Named isoforms=6; Comment=Additional isoforms seem to exist. They arise due to a two alternate splice sites, the first site involves splicing of exons 21-24 while the second site involves exons 36-40.; Name=1; IsoId=Q5VT25-1; Sequence=Displayed; Name=2; IsoId=Q5VT25-2; Sequence=VSP_051861, VSP_051863; Name=3; IsoId=Q5VT25-3; Sequence=VSP_051859, VSP_051860; Name=4; IsoId=Q5VT25-4; Sequence=VSP_051862; Name=5; IsoId=Q5VT25-5; Sequence=VSP_051860; Name=6; IsoId=Q5VT25-6; Sequence=VSP_051860, VSP_035286
Alternative Sequence
550..630; Missing (in isoform 3); 969..1009; Missing (in isoform 4); 969..981; Missing (in isoform 3, isoform 5 and isoform 6); 969; R -> TDPVENTYVWNPSVKFHIQSRST (in isoform 2); 973..981; CTPASKGRR -> TSSEAEPVK (in isoform 2); 1597; M -> MPGFPYPSPHHHSGLISSPINFEHIYHMTVNSAEKFLSPDSINPEYSPSLRSVPGTPSFMTLR (in isoform 6)
Domain & Motif Annotations
Compositional Bias
1604..1619; Polar residues; 1625..1640; Low complexity; 1665..1674; Low complexity; 1697..1707; Low complexity
Coiled Coil
437..820; 880..943
Zinc Finger
1012..1062; Phorbol-ester/DAG-type
Domain (FT)
77..343; Protein kinase; 344..414; AGC-kinase C-terminal; 1082..1201; PH; 1227..1499; CNH; 1571..1584; CRIB
Region
968..1003; Disordered; 1591..1732; Disordered
Protein Families (3)
- Protein kinase superfamily
- AGC Ser/Thr protein kinase family
- DMPK subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. DMPK subfamily.
Clinical Relevance
Drug Targets
Literature-reported target
Drugs (11)
Interaction Protein (4)
ENSG00000070831ENSG00000108953ENSG00000164924ENSG00000198752
Interaction Count
4
Interaction Dataset (2)
intact_biogrid_opencellbiogrid_opencell
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 27863537 | High-resolution proteomic and lipidomic analysis of exosomes and microvesicles from different cell sources. | No related sentences available |
| 32944193 | Extracellular vesicles from human iPSC-derived neural stem cells: miRNA and protein signatures, and anti-inflammatory and neurogenic properties. | No related sentences available |