Protein detail

SPAT1

Spermatogenesis-associated protein 1 (Sperm-specific protein SP-2)

Entry name SPAT1	UniProt ID Q5VX52	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information6

Protein Names

Spermatogenesis-associated protein 1 (Sperm-specific protein SP-2)

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000122432

Entrez Gene Symbol

SPATA1

Supporting publications (n)

EVMP confidence score

0.38

Function & Pathway4

Protein Function

Predicted intracellular proteins

Cellular Component

GO:0001669 acrosomal vesicle

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence12

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (7)

7 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
ALG5 AP3B2 CCDC126 EDA FITM2 GPM6A MFF MGAT5 SPATA19	P51674 Q09328 Q13367 Q7Z5L4 Q8N6M3 Q92838 Q96EE4 Q9GZY8 Q9Y673	0:0:0:0:0:0:0:0:0	hu.MAP2
CCDC126 FITM2 GPM6A MFF MGAT5 SPATA19	P51674 Q09328 Q7Z5L4 Q8N6M3 Q96EE4 Q9GZY8	0:0:0:0:0:0	hu.MAP2
CCDC126 GPM6A MFF SPATA19	P51674 Q7Z5L4 Q96EE4 Q9GZY8	0:0:0:0	hu.MAP2
SCYL2 SPATA1	Q5VX52 Q6P3W7	0:0	hu.MAP2
SCYL2 SPATA1 WNK1 WNK2	Q5VX52 Q6P3W7 Q9H4A3 Q9Y3S1	0:0:0:0	hu.MAP2
SCYL2 SPATA1 WNK2	Q5VX52 Q6P3W7 Q9Y3S1	0:0:0	hu.MAP2
CCDC126 MFF SPATA19	Q7Z5L4 Q96EE4 Q9GZY8	0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	38225453

Sequence, Structure & Domains8

Sequences

Length

459

Mass

52,946

Sequence

MKKDKKRNKIPIDNYPIQTLVNMSLNPSRPSSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDAIAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPVMDHLGNVYSPSTVILDERQTNNGVNEADGTIHRPISVTLFKEELGRDPSLLENTLKELPNKNQEEAGGKATAEKSQIAKNQIGNSELPGSLEDSNNDCFGTKKSQCLWENEDDTAISRRQDNQTAEKEYITLPDHPSLPCQPVLSSGITDISLLQTEREKIIKQMKQVKEERRYLERNREELVKTVEKLFEQSKLKRYHAYNGWKKKYLETKKVTASMEEVLTKLREDLELYYKKLLMQLEAREIKMRPKNLANITDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLIVEVKMRKQAVSDLRTLKTELAQKKKIIHLYNLN

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q5VX52-1; Sequence=Displayed; Name=2; IsoId=Q5VX52-2; Sequence=VSP_035223, VSP_035224; Name=3; IsoId=Q5VX52-4; Sequence=VSP_039875

Alternative Sequence

243..284; QCLWENEDDTAISRRQDNQTAEKEYITLPDHPSLPCQPVLSS -> VFGKMKMIQLSVEDRTIRQLKKSTSPYQITLHFLVNLFFLQE (in isoform 2); 285..459; Missing (in isoform 2); 359..459; Missing (in isoform 3)

Domain & Motif Annotations

Compositional Bias

193..205; Basic and acidic residues

Coiled Coil

287..374; 400..453

Region

193..213; Disordered

Supporting Publications1

PMID	Title	Abstract
40222457	Proteome alterations in peripheral immune cells of DLBCL patients and evidence of cancer extracellular vesicles involvement.	No abstract available