Protein detail
SPAT1
Spermatogenesis-associated protein 1 (Sperm-specific protein SP-2)
Entry name SPAT1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information6
Protein Names
Spermatogenesis-associated protein 1 (Sperm-specific protein SP-2)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.38
Function & Pathway4
Protein Function
Predicted intracellular proteins
Cellular Component
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence12
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ALG5AP3B2CCDC126EDAFITM2GPM6AMFFMGAT5SPATA19 | P51674Q09328Q13367Q7Z5L4Q8N6M3Q92838Q96EE4Q9GZY8Q9Y673 | 0:0:0:0:0:0:0:0:0 | hu.MAP2 | |||
| CCDC126FITM2GPM6AMFFMGAT5SPATA19 | P51674Q09328Q7Z5L4Q8N6M3Q96EE4Q9GZY8 | 0:0:0:0:0:0 | hu.MAP2 | |||
| CCDC126GPM6AMFFSPATA19 | P51674Q7Z5L4Q96EE4Q9GZY8 | 0:0:0:0 | hu.MAP2 | |||
| SCYL2SPATA1 | Q5VX52Q6P3W7 | 0:0 | hu.MAP2 | |||
| SCYL2SPATA1WNK1WNK2 | Q5VX52Q6P3W7Q9H4A3Q9Y3S1 | 0:0:0:0 | hu.MAP2 | |||
| SCYL2SPATA1WNK2 | Q5VX52Q6P3W7Q9Y3S1 | 0:0:0 | hu.MAP2 | |||
| CCDC126MFFSPATA19 | Q7Z5L4Q96EE4Q9GZY8 | 0:0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38225453 |
Sequence, Structure & Domains8
Sequences
Length
459
Mass
52,946
Sequence
MKKDKKRNKIPIDNYPIQTLVNMSLNPSRPSSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDAIAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPVMDHLGNVYSPSTVILDERQTNNGVNEADGTIHRPISVTLFKEELGRDPSLLENTLKELPNKNQEEAGGKATAEKSQIAKNQIGNSELPGSLEDSNNDCFGTKKSQCLWENEDDTAISRRQDNQTAEKEYITLPDHPSLPCQPVLSSGITDISLLQTEREKIIKQMKQVKEERRYLERNREELVKTVEKLFEQSKLKRYHAYNGWKKKYLETKKVTASMEEVLTKLREDLELYYKKLLMQLEAREIKMRPKNLANITDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLIVEVKMRKQAVSDLRTLKTELAQKKKIIHLYNLN
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q5VX52-1; Sequence=Displayed; Name=2; IsoId=Q5VX52-2; Sequence=VSP_035223, VSP_035224; Name=3; IsoId=Q5VX52-4; Sequence=VSP_039875
Alternative Sequence
243..284; QCLWENEDDTAISRRQDNQTAEKEYITLPDHPSLPCQPVLSS -> VFGKMKMIQLSVEDRTIRQLKKSTSPYQITLHFLVNLFFLQE (in isoform 2); 285..459; Missing (in isoform 2); 359..459; Missing (in isoform 3)
Domain & Motif Annotations
Compositional Bias
193..205; Basic and acidic residues
Coiled Coil
287..374; 400..453
Region
193..213; Disordered
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 40222457 | Proteome alterations in peripheral immune cells of DLBCL patients and evidence of cancer extracellular vesicles involvement. | No abstract available |