Protein detail

CARL1

F-actin-uncapping protein LRRC16A (CARMIL homolog) (Capping protein regulator and myosin 1 linker protein 1) (Capping protein, Arp2/3 and myosin-I linker homolog 1) (Capping protein, Arp2/3 and myosin-I linker protein 1) (Leucine-rich repeat-containing protein 16A)

Entry name CARL1	UniProt ID Q5VZK9	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000079691

Entrez Gene Symbol

CARMIL1

Gene Synonym (5)

CARMILdJ501N12.1FLJ20048LRRC16LRRC16A

Gene Description

Capping protein regulator and myosin 1 linker 1

Chromosome

Position

25279078-25620530

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Tissue Specificskeletal muscleCell SpecificAdipocytesSingle-Nuclei Brain Specificupper rhombic lip

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (9)

Molecular Function (2)

Biological Process (3)

Reactome (2)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence8

Ligand-Receptor Signaling (6)

6 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	CARMIL1 RPP30 SLAIN2	P78346 Q5VZK9 Q9P270	0:0:0	Havugimana2012	Havugimana2012:C_125

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blottingR SequencingFlow cytometryELISA	5	38731868 24505114 38490958 31588238 32231660

Sequence, Structure & Domains15

Sequences

Length

1,371

Mass

151,557

Sequence

MTEESSDVPRELIESIKDVIGRKIKISVKKKVKLEVKGDKVENKVLVLTSCRAFLVTARIPTKLELTFSYLEIHGVVCSKSAQMIVETEKCSISMKMASPEDVSEVLAHIGTCLRKIFPGLSPVRIMKKVSMEPSERLASLQALWDSQTVAEQGPCGGFSQMYACVCDWLGFSYREEVQWDVDTIYLTQDTRELNLQDFSHLDHRDLIPIIAALEYNQWFTKLSSKDLKLSTDVCEQILRVVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHTINLAGNPLEDRGVSSLSIQFAKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTASTLVHLDLSGNVLRGDDLSHMYNFLAQPNAIVHLDLSNTECSLDMVCGALLRGCLQYLAVLNLSRTVFSHRKGKEVPPSFKQFFSSSLALMHINLSGTKLSPEPLKALLLGLACNHNLKGVSLDLSNCELRSGGAQVLEGCIAEIHNITSLDISDNGLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSKNLTPVLDNLVQMIQDEESPLQSLSLADSKLKTEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTKLRTVIWDKNNITAQGFQDIAVAMEKNYTLRFMPIPMYDASQALKTNPEKTEDALQKIENYLLRNHETRKYLQEQAYRLQQGIVTSTTQQMIDRICVKVQDHLNSLRNCGGDAIQEDLKSAERLMRDAKNSKTLLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRVVDEQLKALLESMVDAAENLCPNVMKKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKISEVKLTVASFLSDRIVDEILDALSHCHHKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDLDKALEEVPIHIEDPPFPSLRQEKRSSGFISELPSEEGKKLEHFTKLRPKRNKKQQPTQAAVCAANIVSQDGEQNGLMGRVDEGVDEFFTKKVTKMDSKKWSTRGSESHELNEGGDEKKKRDSRKSSGFLNLIKSRSKSERPPTILMTEEPSSPKGAVRSPPVDCPRKDTKAAEHNGNSERIEEIKTPDSFEESQGEEIGKVERSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPALSGVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEAGSRSRSSSSTPTSPKPLLQSPKPSLAARPVIPQKPRTASRPDDIPDSPSSPKVALLPPVLKKVPSDKERDGQSSPQPSPRTFSQEVSRRSWGQQAQEYQEQKQRSSSKDGHQGSKSNDSGEEAEKEFIFV

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=CARMIL1a; IsoId=Q5VZK9-1; Sequence=Displayed; Name=2; IsoId=Q5VZK9-2; Sequence=VSP_032420; Name=3; IsoId=Q5VZK9-3; Sequence=VSP_032418, VSP_032419; Name=4; IsoId=Q5VZK9-4; Sequence=VSP_032415, VSP_032416, VSP_032417

Alternative Sequence

1..161; Missing (in isoform 4); 292..337; GVSSLSIQFAKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTAS -> ETTTKIKRQNVPTVLQTYLVVCPSDYQPCPLPLGKDNYYSDFSHDG (in isoform 4); 338..1371; Missing (in isoform 4); 486..499; SLDISDNGLESDLS -> QLGTRYRNAVLRVY (in isoform 3); 500..1371; Missing (in isoform 3); 1177..1221; Missing (in isoform 2)

3D Structural Models

Helix

985..988; 1026..1029

Beta Strand

978..980; 999..1002

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

977..986; Basic and acidic residues; 1036..1061; Basic and acidic residues; 1106..1130; Basic and acidic residues; 1139..1148; Basic and acidic residues; 1190..1199; Polar residues; 1231..1243; Basic and acidic residues; 1244..1265; Low complexity; 1313..1326; Polar residues; 1340..1353; Basic and acidic residues

Repeat

245..269; LRR 1; 275..298; LRR 2; 304..327; LRR 3; 336..363; LRR 4; 391..418; LRR 5; 423..447; LRR 6; 481..506; LRR 7; 543..566; LRR 8; 570..593; LRR 9; 654..678; LRR 10; 958..981; LRR 11

Coiled Coil

710..734

Domain (CC)

The C-terminus is necessary for localization to the cell membrane (PubMed:26578515).

Region

957..1000; Disordered; 958..1082; Inhibits capping activity of CAPZA2; 1036..1159; Disordered; 1055..1089; Necessary for localization at the cell membrane; 1172..1371; Disordered

Protein Families

CARMIL family

Sequence Similarities

Belongs to the CARMIL family.

Clinical Relevance4

Antibody (2)

HPA029038 HPA029039

Interaction Protein (2)

ENSG00000077549ENSG00000198898

Interaction Count

Interaction Dataset (2)

biogrid_opencellbiogrid_bioplex

Supporting Publications1

PMID	Title	Abstract
30915084	Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton.	No abstract available