Protein detail
ZDH20
Palmitoyltransferase ZDHHC20 (EC 2.3.1.225) (Acyltransferase ZDHHC20) (EC 2.3.1.-) (DHHC domain-containing cysteine-rich protein 20) (DHHC20) (Zinc finger DHHC domain-containing protein 20)
Entry name ZDH20 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 4 | Protein classification EnzymesMetabolic proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Palmitoyltransferase ZDHHC20 (EC 2.3.1.225) (Acyltransferase ZDHHC20) (EC 2.3.1.-) (DHHC domain-containing cysteine-rich protein 20) (DHHC20) (Zinc finger DHHC domain-containing protein 20)
Protein Class (4)
EnzymesMetabolic proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Transporters:Accessory Factors Involved in Transport
Transmembrane
15..35; Helical; 54..74; Helical; 170..190; Helical; 208..231; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
DHHC20FLJ25952
Gene Description
Zinc finger DHHC-type palmitoyltransferase 20
Chromosome
13
Position
21348784-21459370
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue Specificbone marrowCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway6
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Transporters:Accessory Factors Involved in Transport
Cellular Component (9)
- GO:0000139 Golgi membrane
- GO:0005783 endoplasmic reticulum
- GO:0005789 endoplasmic reticulum membrane
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0016020 membrane
- GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
- GO:0043231 intracellular membrane-bounded organelle
- GO:0048471 perinuclear region of cytoplasm
Molecular Function (6)
Biological Process (3)
Reactome (7)
Mediation Categories
Clinical-translation mediation
Relations & Evidence17
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
Page 1 of 2Next
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ALG11ARF1COPESACM1LVAPBZDHHC20 | O14579O95292P84077Q2TAA5Q5W0Z9Q9NTJ5 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4097 | ||
| DKC1NOP10SHQ1UBCWDR48ZDHHC20 | O60832P0CG48Q5W0Z9Q6PI26Q8TAF3Q9NPE3 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7210 | ||
| CAND1COPS2COPS3COPS4COPS6COPS7BCUL1CUL2CUL3CUL4ACUL4BDDB1RBX1ZDHHC20 | P61201P62877Q13616Q13617Q13618Q13619Q13620Q16531Q5W0Z9Q7L5N1Q86VP6Q9BT78Q9H9Q2Q9UNS2 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC3679 | ||
| ZDHHC20 | Q5W0Z9 | 2 | PDB | PDB:7khmPDB:6bmmPDB:6bmlPDB:6bmn |
Sequence, Structure & Domains13
Sequences
Length
365
Mass
42,278
Sequence
MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q5W0Z9-1; Sequence=Displayed; Name=2; IsoId=Q5W0Z9-2; Sequence=VSP_016276, VSP_016277; Name=3; IsoId=Q5W0Z9-3; Sequence=VSP_040481, VSP_040482; Name=4; IsoId=Q5W0Z9-4; Sequence=VSP_056002
Alternative Sequence
124..130; TIRYCEK -> SLMQSTK (in isoform 2); 131..365; Missing (in isoform 2); 315..365; SSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN -> RSKLQR (in isoform 4); 315; Missing (in isoform 3); 355..365; TNNHVTVAIEN -> V (in isoform 3)
3D Structural Models
Turn
43..46; 112..115; 129..132; 143..146; 165..167; 256..259
Helix
7..14; 17..34; 35..42; 48..74; 82..84; 90..96; 100..111; 157..159; 168..197; 204..237; 241..245; 263..271; 275..277
Beta Strand
140..142; 147..149; 154..156; 161..164; 280..282; 295..297
3D Structure
X-ray crystallography (4)
Domain & Motif Annotations
Domain (CC)
The DHHC domain is required for palmitoyltransferase activity.
Domain (FT)
126..176; DHHC
Protein Families
DHHC palmitoyltransferase family
Sequence Similarities
Belongs to the DHHC palmitoyltransferase family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |