Protein detail

LEMD1

LEM domain-containing protein 1 (Cancer/testis antigen 50) (CT50) (LEM domain protein 1) (LEMP-1)

Entry name LEMD1	UniProt ID Q68G75	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

LEM domain-containing protein 1 (Cancer/testis antigen 50) (CT50) (LEM domain protein 1) (LEMP-1)

Protein Function

Predicted intracellular proteins

Transmembrane

152..172; Helical; Signal-anchor for type II membrane protein

Transmembrane Count

Ensembl

ENSG00000186007

Entrez Gene Symbol

LEMD1

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Tissue Specificheart muscleCell SpecificCardiomyocytes

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component

GO:0016020 membrane

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence13

Ligand-Receptor Signaling (12)

12 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane_sosui	transmembrane_predicted	Almen2009	No	No	No	No	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	No	No	No

Page 2 of 2Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Western blotting	2	40928027 38731868

Sequence, Structure & Domains6

Sequences

Length

181

Mass

20,326

Sequence

MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDGAQDSDDSEELNIILQGNIILSTEKSKKLKKWPEASTTKRKAVDTYCLDYKPSKGRRWAARAPSTRITYGTITKERDYCAEDQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSLFG

Alternative Products

Event=Alternative splicing; Named isoforms=6; Name=1; Synonyms=LEMD1A; IsoId=Q68G75-1; Sequence=Displayed; Name=2; Synonyms=LEMD1B; IsoId=Q68G75-2; Sequence=VSP_024848, VSP_024849; Name=3; Synonyms=LEMD1C; IsoId=Q68G75-3; Sequence=VSP_024846; Name=4; Synonyms=LEMD1D; IsoId=Q68G75-4; Sequence=VSP_024852, VSP_024853; Name=5; Synonyms=LEMD1E; IsoId=Q68G75-5; Sequence=VSP_024851, VSP_024854; Name=6; Synonyms=LEMD1F; IsoId=Q68G75-6; Sequence=VSP_024847, VSP_024850

Alternative Sequence

28..69; PSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDGAQDSDDSEE -> Q (in isoform 3); 28..67; PSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDGAQDSDDS -> RGLQEHQAPESHMGLSPKRETTARKTRLSRAGEKKVSQWA (in isoform 6); 28..29; PS -> LA (in isoform 2); 30..181; Missing (in isoform 2); 68..181; Missing (in isoform 6); 69..108; ELNIILQGNIILSTEKSKKLKKWPEASTTKRKAVDTYCLD -> GGLQEHQAPESHMGLSPKRETTARKTRLSRAGEKKVSQWA (in isoform 5); 69..70; EL -> VA (in isoform 4); 71..181; Missing (in isoform 4); 109..181; Missing (in isoform 5)

Domain & Motif Annotations

Domain (FT)

1..45; LEM

Supporting Publications1

PMID	Title	Abstract
34265469	Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer.	Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes.