Protein detail

TTLL5

Tubulin polyglutamylase TTLL5 (EC 6.3.2.-) (SRC1 and TIF2-associated modulatory protein) (STAMP protein) (Tubulin--tyrosine ligase-like protein 5)

Entry name TTLL5	UniProt ID Q6EMB2	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Tubulin polyglutamylase TTLL5 (EC 6.3.2.-) (SRC1 and TIF2-associated modulatory protein) (STAMP protein) (Tubulin--tyrosine ligase-like protein 5)

Protein Class (3)

Disease related genesHuman disease related genesPredicted intracellular proteins

Protein Function (3)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Eye disease

Ensembl

ENSG00000119685

Entrez Gene Symbol

TTLL5

Gene Synonym (2)

KIAA0998STAMP

Gene Description

Tubulin tyrosine ligase like 5

Chromosome

Position

75633625-75955079

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Cell SpecificAstrocytes

Function & Pathway6

Protein Function (3)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Eye disease

Cellular Component (6)

Molecular Function (4)

Biological Process (3)

Reactome (2)

Mediation Categories

Metabolism mediation

Relations & Evidence11

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (6)

6 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
FIZ1 TTLL5 UNK VWCE ZNF302 ZNF391 ZNF460 ZNF552 ZNF620 ZNF623 ZNF627 ZNF664 ZNF696 ZNF74 ZNF77 ZNF8	O75123 P17098 Q14592 Q15935 Q16587 Q6EMB2 Q6ZNG0 Q7L945 Q8N3J9 Q96DN2 Q96SL8 Q9C0B0 Q9H707 Q9H7X3 Q9NR11 Q9UJN7	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
BBS4 C2CD3 CCDC138 CCDC14 CCDC18 CCDC61 CEP20 CEP295 CSPP1 KIAA1328 MIB1 OFD1 PCM1 PIBF1 SSX2IP TBC1D31 TTLL5 WDR90	O75665 Q15154 Q1MSJ5 Q49A88 Q4AC94 Q5T9S5 Q6EMB2 Q86T90 Q86YT6 Q8WXW3 Q96DN5 Q96KV7 Q96M89 Q96NB1 Q96RK4 Q9C0D2 Q9Y2D8 Q9Y6R9	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP
CEP19 CEP350 CEP43 PPP2R3C TTLL5	O95684 Q5VT06 Q6EMB2 Q969Q6 Q96LK0	0:0:0:0:0	hu.MAP2
CCDC14 TTLL5	Q49A88 Q6EMB2	0:0	hu.MAP2
CCDC14 KIAA1328 TTLL5	Q49A88 Q6EMB2 Q86T90	0:0:0	hu.MAP
CEP295 KIAA1328 TTLL5	Q6EMB2 Q86T90 Q9C0D2	0:0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	39329301

Sequence, Structure & Domains11

Sequences

Length

1,281

Mass

143,577

Sequence

MPIVMARDLEETASSSEDEEVISQEDHPCIMWTGGCRRIPVLVFHADAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRASTRPIYPTFESSRRNPFQKPQRCRPLSASDAEMKNLVGSAREKGPGKLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIYGSYLEHKTSMNYMLATRLFQDRMTADGAPELKIESLNSKAKLHAALYERKLLSLEVRKRRRRSSRLRAMRPKYPVITQPAEMNVKTETESEEEEEVALDNEDEEQEASQEESAGFLRENQAKYTPSLTALVENTPKENSMKVREWNNKGGHCCKLETQELEPKFNLMQILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKEDEQMELVVRFLKRASNNLQHSLRMVLPSRRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVFLGTHSKISKNNNNYSDSGAKGDHPETIMEEVKIKPPKQQQTTEIHSDKLSRFTTSAEKEAKLVYSNSSSGPTATLQKIPNTHLSSVTTSDLSPGPCHHSSLSQIPSAIPSMPHQPTILLNTVSASASPCLHPGAQNIPSPTGLPRCRSGSHTIGPFSSFQSAAHIYSQKLSRPSSAKAGSCYLNKHHSGIAKTQKEGEDASLYSKRYNQSMVTAELQRLAEKQAARQYSPSSHINLLTQQVTNLNLATGIINRSSASAPPTLRPIISPSGPTWSTQSDPQAPENHSSSPGSRSLQTGGFAWEGEVENNVYSQATGVVPQHKYHPTAGSYQLQFALQQLEQQKLQSRQLLDQSRARHQAIFGSQTLPNSNLWTMNNGAGCRISSATASGQKPTTLPQKVVPPPSSCASLVPKPPPNHEQVLRRATSQKASKGSSAEGQLNGLQSSLNPAAFVPITSSTDPAHTKI

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q6EMB2-1; Sequence=Displayed; Name=2; IsoId=Q6EMB2-2; Sequence=VSP_037453, VSP_037456, VSP_037457; Name=3; IsoId=Q6EMB2-3; Sequence=VSP_037454, VSP_037455

Alternative Sequence

1..462; Missing (in isoform 2); 248..269; FATVRYDQGAKNIRNQFMHLTN -> KCNWKMGNTMDKRRLPIYVQVL (in isoform 3); 270..1281; Missing (in isoform 3); 516; D -> DRGNPRRSLLTGRT (in isoform 2); 1247..1281; KGSSAEGQLNGLQSSLNPAAFVPITSSTDPAHTKI -> NTRFRSSFQNYLWYFFQAVS (in isoform 2)

Domain & Motif Annotations

Compositional Bias

584..604; Acidic residues; 1086..1113; Polar residues; 1199..1212; Polar residues; 1240..1263; Polar residues; 1270..1281; Polar residues

Domain (CC)

The flexible c-MTBD (cationic microtubule binding domain) region mediates binding to microtubules. It is positively charged and becomes ordered when bound to microtubules: it interacts with a negatively charged patch on tubulin. The presence of positive charges in the c-MTBD region is essential for proper binding.; DOMAIN: Arg-186 is the main determinant for regioselectivity, which segregates between initiases and elongases in all tubulin--tyrosine ligase family. A glutamine residue at this position is found in elongases TTLL6, TTLL9, TTLL11, TTLL13, TTLL10 and favors glutamate-chain elongation, whereas an arginine residue is found in initiases TTLL2, TTLL4, TTLL5, TTLL3, TTLL8 and favors initiation.

Domain (FT)

62..407; TTL

Region

378..488; c-MTBD region; 577..614; Disordered; 1072..1114; Disordered; 1199..1281; Disordered

Protein Families

Tubulin--tyrosine ligase family

Sequence Similarities

Belongs to the tubulin--tyrosine ligase family.

Clinical Relevance2

Disease Involvement (2)

Cone-rod dystrophyDisease variant

Antibody

HPA032128

Supporting Publications1

PMID	Title	Abstract
27894104	Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers.	No abstract available