Protein detail
TTLL5
Tubulin polyglutamylase TTLL5 (EC 6.3.2.-) (SRC1 and TIF2-associated modulatory protein) (STAMP protein) (Tubulin--tyrosine ligase-like protein 5)
Entry name TTLL5 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Tubulin polyglutamylase TTLL5 (EC 6.3.2.-) (SRC1 and TIF2-associated modulatory protein) (STAMP protein) (Tubulin--tyrosine ligase-like protein 5)
Protein Class (3)
Disease related genesHuman disease related genesPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Eye disease
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
KIAA0998STAMP
Gene Description
Tubulin tyrosine ligase like 5
Chromosome
14
Position
75633625-75955079
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization2
Cell SpecificAstrocytes
Function & Pathway6
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Eye disease
Cellular Component (6)
Molecular Function (4)
Biological Process (3)
Reactome (2)
Mediation Categories
Metabolism mediation
Relations & Evidence11
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| FIZ1TTLL5UNKVWCEZNF302ZNF391ZNF460ZNF552ZNF620ZNF623ZNF627ZNF664ZNF696ZNF74ZNF77ZNF8 | O75123P17098Q14592Q15935Q16587Q6EMB2Q6ZNG0Q7L945Q8N3J9Q96DN2Q96SL8Q9C0B0Q9H707Q9H7X3Q9NR11Q9UJN7 | 0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0 | hu.MAP2 | |||
| BBS4C2CD3CCDC138CCDC14CCDC18CCDC61CEP20CEP295CSPP1KIAA1328MIB1OFD1PCM1PIBF1SSX2IPTBC1D31TTLL5WDR90 | O75665Q15154Q1MSJ5Q49A88Q4AC94Q5T9S5Q6EMB2Q86T90Q86YT6Q8WXW3Q96DN5Q96KV7Q96M89Q96NB1Q96RK4Q9C0D2Q9Y2D8Q9Y6R9 | 0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0 | hu.MAP | |||
| CEP19CEP350CEP43PPP2R3CTTLL5 | O95684Q5VT06Q6EMB2Q969Q6Q96LK0 | 0:0:0:0:0 | hu.MAP2 | |||
| CCDC14TTLL5 | Q49A88Q6EMB2 | 0:0 | hu.MAP2 | |||
| CCDC14KIAA1328TTLL5 | Q49A88Q6EMB2Q86T90 | 0:0:0 | hu.MAP | |||
| CEP295KIAA1328TTLL5 | Q6EMB2Q86T90Q9C0D2 | 0:0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 39329301 |
Sequence, Structure & Domains11
Sequences
Length
1,281
Mass
143,577
Sequence
MPIVMARDLEETASSSEDEEVISQEDHPCIMWTGGCRRIPVLVFHADAILTKDNNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRASTRPIYPTFESSRRNPFQKPQRCRPLSASDAEMKNLVGSAREKGPGKLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSETWEIYGSYLEHKTSMNYMLATRLFQDRMTADGAPELKIESLNSKAKLHAALYERKLLSLEVRKRRRRSSRLRAMRPKYPVITQPAEMNVKTETESEEEEEVALDNEDEEQEASQEESAGFLRENQAKYTPSLTALVENTPKENSMKVREWNNKGGHCCKLETQELEPKFNLMQILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKEDEQMELVVRFLKRASNNLQHSLRMVLPSRRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVFLGTHSKISKNNNNYSDSGAKGDHPETIMEEVKIKPPKQQQTTEIHSDKLSRFTTSAEKEAKLVYSNSSSGPTATLQKIPNTHLSSVTTSDLSPGPCHHSSLSQIPSAIPSMPHQPTILLNTVSASASPCLHPGAQNIPSPTGLPRCRSGSHTIGPFSSFQSAAHIYSQKLSRPSSAKAGSCYLNKHHSGIAKTQKEGEDASLYSKRYNQSMVTAELQRLAEKQAARQYSPSSHINLLTQQVTNLNLATGIINRSSASAPPTLRPIISPSGPTWSTQSDPQAPENHSSSPGSRSLQTGGFAWEGEVENNVYSQATGVVPQHKYHPTAGSYQLQFALQQLEQQKLQSRQLLDQSRARHQAIFGSQTLPNSNLWTMNNGAGCRISSATASGQKPTTLPQKVVPPPSSCASLVPKPPPNHEQVLRRATSQKASKGSSAEGQLNGLQSSLNPAAFVPITSSTDPAHTKI
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q6EMB2-1; Sequence=Displayed; Name=2; IsoId=Q6EMB2-2; Sequence=VSP_037453, VSP_037456, VSP_037457; Name=3; IsoId=Q6EMB2-3; Sequence=VSP_037454, VSP_037455
Alternative Sequence
1..462; Missing (in isoform 2); 248..269; FATVRYDQGAKNIRNQFMHLTN -> KCNWKMGNTMDKRRLPIYVQVL (in isoform 3); 270..1281; Missing (in isoform 3); 516; D -> DRGNPRRSLLTGRT (in isoform 2); 1247..1281; KGSSAEGQLNGLQSSLNPAAFVPITSSTDPAHTKI -> NTRFRSSFQNYLWYFFQAVS (in isoform 2)
Domain & Motif Annotations
Compositional Bias
584..604; Acidic residues; 1086..1113; Polar residues; 1199..1212; Polar residues; 1240..1263; Polar residues; 1270..1281; Polar residues
Domain (CC)
The flexible c-MTBD (cationic microtubule binding domain) region mediates binding to microtubules. It is positively charged and becomes ordered when bound to microtubules: it interacts with a negatively charged patch on tubulin. The presence of positive charges in the c-MTBD region is essential for proper binding.; DOMAIN: Arg-186 is the main determinant for regioselectivity, which segregates between initiases and elongases in all tubulin--tyrosine ligase family. A glutamine residue at this position is found in elongases TTLL6, TTLL9, TTLL11, TTLL13, TTLL10 and favors glutamate-chain elongation, whereas an arginine residue is found in initiases TTLL2, TTLL4, TTLL5, TTLL3, TTLL8 and favors initiation.
Domain (FT)
62..407; TTL
Region
378..488; c-MTBD region; 577..614; Disordered; 1072..1114; Disordered; 1199..1281; Disordered
Protein Families
Tubulin--tyrosine ligase family
Sequence Similarities
Belongs to the tubulin--tyrosine ligase family.
Clinical Relevance2
Disease Involvement (2)
Cone-rod dystrophyDisease variant
Antibody
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |