Protein detail

IQCE

IQ domain-containing protein E

Entry name IQCE	UniProt ID Q6IPM2	EVMP confidence score 0.50
Supporting publications (n) 5	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

IQ domain-containing protein E

Protein Class (3)

Disease related genesHuman disease related genesPredicted intracellular proteins

Protein Function (3)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system

Ensembl

ENSG00000106012

Entrez Gene Symbol

IQCE

Gene Synonym

KIAA1023

Gene Description

IQ motif containing E

Chromosome

Position

2558972-2614733

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization5

Tissue SpecificlungBrain Regional Specificchoroid plexusCell SpecificVascular endothelial cellsSingle-Nuclei Brain Specificendothelial cell

Function & Pathway7

Protein Function (3)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system

Cellular Component (2)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG

hsa04340 Hedgehog signaling pathway

Reactome (3)

Mediation Categories

Receptor-signaling mediation

Relations & Evidence5

Ligand-Receptor Signaling (3)

3 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	IQCE TTC23L	Q6IPM2 Q6PF05	0:0	hu.MAPhu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	9	40189497 38207106 36146834 38113368 33592500 32916986 41307968 31805958 37926756

Sequence, Structure & Domains9

Sequences

Length

695

Mass

77,298

Sequence

MFLGTGEPALDTGDDSLSAVTFDSDVETKAKRKAFHKPPPTSPKSPYLSKPRKVASWRSLRTAGSMPLGGRASLTPQKLWLGTAKPGSLTQALNSPLTWEHAWTGVPGGTPDCLTDTFRVKRPHLRRSASNGHVPGTPVYREKEDMYDEIIELKKSLHVQKSDVDLMRTKLRRLEEENSRKDRQIEQLLDPSRGTDFVRTLAEKRPDASWVINGLKQRILKLEQQCKEKDGTISKLQTDMKTTNLEEMRIAMETYYEEVHRLQTLLASSETTGKKPLGEKKTGAKRQKKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKPRLLRRIVELEKKLSVMESSKSHAAEPVRSHPPACLASSSALHRQPRGDRNKDHERLRGAVRDLKEERTALQEQLLQRDLEVKQLLQAKADLEKELECAREGEEERREREEVLREEIQTLTSKLQELQEMKKEEKEDCPEVPHKAQELPAPTPSSRHCEQDWPPDSSEEGLPRPRSPCSDGRRDAAARVLQAQWKVYKHKKKKAVLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVPGLPDQSSPVPRVPSPIAQATGSPVQEEAIVIIQSALRAHLARARHSATGKRTTTAASTRRRSASATHGDASSPPFLAALPDPSPSGPQALAPLPGDDVNSDDSDDIVIAPSLPTKNFPV

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q6IPM2-1; Sequence=Displayed; Name=2; IsoId=Q6IPM2-2; Sequence=VSP_024433; Name=3; IsoId=Q6IPM2-3; Sequence=VSP_024435; Name=4; IsoId=Q6IPM2-4; Sequence=VSP_024434

Alternative Sequence

1..65; Missing (in isoform 2); 12..27; Missing (in isoform 4); 13..70; GDDSLSAVTFDSDVETKAKRKAFHKPPPTSPKSPYLSKPRKVASWRSLRTAGSMPLGG -> SHLISLS (in isoform 3)

Domain & Motif Annotations

Compositional Bias

465..482; Basic and acidic residues

Coiled Coil

157..264; 292..358; 387..477

Domain (FT)

542..571; IQ 1; 601..630; IQ 2

Region

29..55; Disordered; 357..390; Disordered; 465..521; Disordered; 564..599; Disordered; 618..695; Disordered

Clinical Relevance4

Antibody

HPA019515

Interaction Protein (2)

ENSG00000100567ENSG00000205838

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications5

PMID	Title	Abstract
35194965	Muscle cells of sporadic amyotrophic lateral sclerosis patients secrete neurotoxic vesicles.	No abstract available
38613149	Proteomic profiling of circulating β-thalassaemia/haemoglobin E extra-cellular vesicles reveals that association with immunoglobulin induces membrane vesiculation.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available
40091455	Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss.	No abstract available
40098346	Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.	No abstract available