Protein detail
S39A4
Zinc transporter ZIP4 (Solute carrier family 39 member 4) (Zrt- and Irt-like protein 4) (ZIP-4)
Entry name S39A4 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) | Transmembrane count 8 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information7
Protein Names
Zinc transporter ZIP4 (Solute carrier family 39 member 4) (Zrt- and Irt-like protein 4) (ZIP-4)
Protein Function (5)
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
Transmembrane
328..348; Helical; Name=1; 360..380; Helical; Name=2; 403..423; Helical; Name=3; 499..518; Helical; Name=4; 527..553; Helical; Name=5; 559..579; Helical; Name=6; 587..607; Helical; Name=7; 618..638; Helical; Name=8
Transmembrane Count
8
Ensembl
Entrez Gene Symbol
EVMP confidence score
0.38
Fluorescence & Localization1
Cell SpecificLate spermatids
Function & Pathway7
Protein Function (5)
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
Cellular Component (4)
Molecular Function (7)
Biological Process (3)
Reactome (7)
- R-hsa-5619115 disorders of transmembrane transporters
- R-hsa-425410 metal ion slc transporters
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-5619102 slc transporter disorders
- R-hsa-382551 transport of small molecules
- R-hsa-442380 zinc influx into cells by the slc39 gene family
- R-hsa-435354 zinc transporters
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence24
Ligand-Receptor Signaling (22)
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transporter | transporter | Surfaceome | No | Yes | No | No | No |
| solute_carrier | transporter | Almen2009 | No | Yes | No | No | No |
| slc39 | transporter | Surfaceome | No | Yes | No | No | No |
| slc | transporter | Surfaceome | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
Page 1 of 3Next
Protein Complex Composition (1)
Sequence, Structure & Domains11
Sequences
Length
647
Mass
68,408
Sequence
MASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTLADRVHCANGPCGKCLSVEDALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCEDARAGLWASHADHLLALLESPKALTPGLSWLLQRMQARAAGQTPKMACVDIPQLLEEAVGAGAPGSAGGVLAALLDHVRSGSCFHALPSPQYFVDFVFQQHSSEVPMTLAELSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNSSSVWDTVCLSARDVMAAYGLSEQAGVTPEAWAQLSPALLQQQLSGACTSQSRPPVQDQLSQSERYLYGSLATLLICLCAVFGLLLLTCTGCRGVTHYILQTFLSLAVGAVTGDAVLHLTPKVLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLEDGPCGHSSHSHGGHSHGVSLQLAPSELRQPKPPHEGSRADLVAEESPELLNPEPRRLSPELRLLPYMITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVRQALLLNLASALTAFAGLYVALAVGVSEESEAWILAVATGLFLYVALCDMLPAMLKVRDPRPWLLFLLHNVGLLGGWTVLLLLSLYEDDITF
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6P5W5-1; Sequence=Displayed; Name=2; IsoId=Q6P5W5-2; Sequence=VSP_015911, VSP_015912
Alternative Sequence
1..25; Missing (in isoform 2); 26..64; AGLLSLLTSGQGALDQEALGGLLNTLADRVHCANGPCGK -> MVDVVGLERETGPRGSPWPGLPLPSLVGPAPLLTCLCPQ (in isoform 2)
Domain & Motif Annotations
Compositional Bias
460..470; Basic and acidic residues
Motif
452..454; Essential for SLC39A4 endocytosis
Domain (CC)
The N-terminal extracellular domain is required for high efficient zinc transport.; DOMAIN: The two metal binding sites M1 and M2 that are halfway through the membrane form a binuclear metal center. M1 is essential to Zn(2+) transport, while the other, M2 appears to have an auxiliary role presumably by acting as an additional transport site that can modulate the properties of the primary transport site (PubMed:28875161, PubMed:31914589). The binuclear metal center plays a key role in Zn(2+) sensing (PubMed:32348750).
Region
236..255; Disordered; 458..484; Disordered
Protein Families
ZIP transporter (TC 2.A.5) family
Sequence Similarities
Belongs to the ZIP transporter (TC 2.A.5) family.