Protein detail

CXB7

Gap junction beta-7 protein (Connexin-25) (Cx25)

Entry name CXB7	UniProt ID Q6PEY0	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 4	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information7

Protein Names

Gap junction beta-7 protein (Connexin-25) (Cx25)

Transmembrane

20..40; Helical; 76..96; Helical; 122..142; Helical; 178..198; Helical

Transmembrane Count

Ensembl

ENSG00000164411

Entrez Gene Symbol

GJB7

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization4

Tissue SpecificlungCell SpecificEndometrial glandular cellsSingle-Nuclei Brain Specificendothelial cellBlood Cell SpecificT-reg

Function & Pathway6

Cellular Component

GO:0005922 connexin complex

Molecular Function

GO:0005243 gap junction channel activity

Biological Process (3)

Reactome (4)

Canonical Pathways

M90 Pid wnt canonical pathway

Mediation Categories

Fusion and delivery mediation

Relations & Evidence21

Ligand-Receptor Signaling (18)

18 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No
cell_surface	cell_surface	Surfaceome	No	No	No	No	No
cell_surface	cell_surface	OmniPath	No	No	No	No	No
receptor	receptor	scConnect	No	Yes	No	No	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	No	No

Page 2 of 2Previous

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	C1orf21 GJB7 UBTD1	Q6PEY0 Q9H246 Q9HAC8	0:0:0	hu.MAP2
	GJB7 UBTD1	Q6PEY0 Q9HAC8	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry [MALDI TOF]\|Mass spectrometry [QTOF]Mass spectrometryMass spectrometry [LTQ-FT Ultra]	45	40985879 26826536 36064647 38113368 28680152 40465195 37322475 34599510 36497184 25755179 34064677 40189497 38895962 41068253 33592500 32854315 38014595 27487081 34473505 38891077 37563857 38917926 30915084 32560723 31617158 41128489 32916986 41307968 36146834 33309826 40840701 37670049 31805958 38607062 32230970 38207106 34576246 37204515 39001700 36982312 37438638 39207047 32854315 37670049 37926756

Sequence, Structure & Domains5

Sequences

Length

223

Mass

25,860

Sequence

MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV

Domain & Motif Annotations

Protein Families (2)

Connexin family
Beta-type (group I) subfamily

Sequence Similarities

Belongs to the connexin family. Beta-type (group I) subfamily.

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available