Protein detail
CXB7
Gap junction beta-7 protein (Connexin-25) (Cx25)
Entry name CXB7 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 4 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information7
Protein Names
Gap junction beta-7 protein (Connexin-25) (Cx25)
Transmembrane
20..40; Helical; 76..96; Helical; 122..142; Helical; 178..198; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization4
Tissue SpecificlungCell SpecificEndometrial glandular cellsSingle-Nuclei Brain Specificendothelial cellBlood Cell SpecificT-reg
Function & Pathway6
Cellular Component
Molecular Function
Biological Process (3)
Reactome (4)
Canonical Pathways
M90 Pid wnt canonical pathway
Mediation Categories
Fusion and delivery mediation
Relations & Evidence21
Ligand-Receptor Signaling (18)
18 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
| cell_surface | cell_surface | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 2 of 2Previous
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry [MALDI TOF]|Mass spectrometry [QTOF]Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 45 | 409858792682653636064647381133682868015240465195373224753459951036497184257551793406467740189497388959624106825333592500328543153801459527487081344735053889107737563857389179263091508432560723316171584112848932916986413079683614683433309826408407013767004931805958386070623223097038207106345762463720451539001700369823123743863839207047328543153767004937926756 |
Sequence, Structure & Domains5
Sequences
Length
223
Mass
25,860
Sequence
MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV
Domain & Motif Annotations
Protein Families (2)
- Connexin family
- Beta-type (group I) subfamily
Sequence Similarities
Belongs to the connexin family. Beta-type (group I) subfamily.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |