Protein detail
DCNL2
DCN1-like protein 2 (DCNL2) (DCUN1 domain-containing protein 2) (Defective in cullin neddylation protein 1-like protein 2)
Entry name DCNL2 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 3 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
DCN1-like protein 2 (DCNL2) (DCUN1 domain-containing protein 2) (Defective in cullin neddylation protein 1-like protein 2)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
C13orf17FLJ10704FLJ20092
Gene Description
Defective in cullin neddylation 1 domain containing 2
Chromosome
13
Position
113455819-113490951
Supporting publications (n)
3
EVMP confidence score
0.38
Fluorescence & Localization5
Tissue Specificlymphoid tissueCell SpecificInnate lymphoid cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificMAIT T-cellBlood Lineage Specificdendritic cells
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function (4)
Biological Process (3)
Canonical Pathways
M160 Pid avb3 integrin pathway
Mediation Categories
Metabolism mediation
Relations & Evidence6
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
Sequence, Structure & Domains11
Sequences
Length
259
Mass
30,179
Sequence
MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6PH85-1; Sequence=Displayed; Name=2; IsoId=Q6PH85-2; Sequence=VSP_015315, VSP_015316
Alternative Sequence
174..186; DLEMAVAYWKLVL -> GSPPFLNVKALHH (in isoform 2); 187..259; Missing (in isoform 2)
3D Structural Models
Turn
187..189
Helix
62..70; 83..92; 100..109; 119..128; 134..146; 147..149; 151..165; 175..185; 193..202; 210..222; 238..247; 249..251
Beta Strand
77..81; 171..174
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (CC)
The DCUN1 domain, also known as PONY domain, mediates the interaction with different cullins (PubMed:23201271). The DCUN1 domain mediates the interaction with the N-terminally acetylated NEDD8-conjugating E2s enzyme leading to the NEDD8 transfer from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes; the neddylation efficiency correlates with the DCUN1D5-cullin and DCUN1D5-E2 interaction affinities (PubMed:23201271).
Domain (FT)
8..45; UBA-like; 60..248; DCUN1
Clinical Relevance1
Antibody
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No abstract available |
| 38490958 | Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer. | No abstract available |