Protein detail
TRAT1
T-cell receptor-associated transmembrane adapter 1 (T-cell receptor-interacting molecule) (TRIM) (pp29/30)
Entry name TRAT1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Predicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
T-cell receptor-associated transmembrane adapter 1 (T-cell receptor-interacting molecule) (TRIM) (pp29/30)
Protein Class (2)
Predicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Transmembrane
8..28; Helical; Signal-anchor for type III membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
HSPC062TCRIMTRIM
Gene Description
T cell receptor associated transmembrane adaptor 1
Chromosome
3
Position
108822770-108855005
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization5
Tissue SpecificbrainBrain Regional Specificbasal gangliaCell SpecificAdrenal medulla cellsSingle-Nuclei Brain Specificmedium spiny neuron
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Reactome (8)
- R-hsa-1280218 adaptive immune system
- R-hsa-2219530 constitutive signaling by aberrant pi3k in cancer
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-202424 downstream tcr signaling
- R-hsa-9006925 intracellular signaling by second messengers
- R-hsa-199418 negative regulation of the pi3k akt network
- R-hsa-2219528 pi3k akt signaling in cancer
- R-hsa-202403 tcr signaling
Canonical Pathways (3)
- M252 Pid il8 cxcr1 pathway
- M177 Pid epha fwdpathway
- M210 Pid il8 cxcr2 pathway
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence22
Enzyme-Mediated Modification (2)
Ligand-Receptor Signaling (19)
19 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationPolymer Precipitation | Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 1 | 32826923 |
Sequence, Structure & Domains5
Sequences
Length
186
Mass
21,211
Sequence
MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN
Domain & Motif Annotations
Compositional Bias
118..128; Basic residues; 131..140; Basic and acidic residues
Region
79..82; Interaction with PIK3R1; 116..140; Disordered
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38037300 | Proteomic profiling of paired human liver homogenate and tissue derived extracellular vesicles. | No abstract available |