Protein detail

AGRD1

Adhesion G-protein coupled receptor D1 (G-protein coupled receptor 133) (G-protein coupled receptor PGR25) [Cleaved into: Adhesion G-protein coupled receptor D1, N-terminal fragment (ADGRD1 N-terminal fragment); Adhesion G-protein coupled receptor D1, C-terminal fragment (ADGRD1 C-terminal fragment)]

Entry name AGRD1	UniProt ID Q6QNK2	EVMP confidence score 0.50
Supporting publications (n) 3	Transmembrane count 7	Protein classification G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Protein Class (3)

G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins

Protein Function (3)

G-protein coupled receptors:Family 2 (B) receptors
Predicted intracellular proteins
G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

568..590; Helical; Name=1; 602..623; Helical; Name=2; 633..655; Helical; Name=3; 674..695; Helical; Name=4; 711..732; Helical; Name=5; 758..780; Helical; Name=6; 784..810; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000111452

Entrez Gene Symbol

ADGRD1

Gene Synonym (3)

DKFZp434B1272GPR133PGR25

Gene Description

Adhesion G protein-coupled receptor D1

Chromosome

Position

130953907-131141469

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Cell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte

Function & Pathway5

Protein Function (3)

G-protein coupled receptors:Family 2 (B) receptors
Predicted intracellular proteins
G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component (5)

Molecular Function (2)

Biological Process (3)

Mediation Categories

Receptor-signaling mediation

Relations & Evidence44

Ligand-Receptor Signaling (43)

43 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
class_b2_adhesion	receptor	GPCRdb	No	Yes	No	Yes	No
class_b2_adhesion_adhesion	receptor	GPCRdb	No	Yes	No	Yes	No
class_b2_adhesion_adhesion_adgrd	receptor	GPCRdb	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
extracellular	extracellular	HPMR	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
adhesion_gprotein_coupled_receptor	matrix_adhesion	HGNC	No	Yes	No	Yes	No

Page 2 of 5Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry	0

Sequence, Structure & Domains15

Sequences

Length

874

Mass

96,530

Sequence

MEKLLRLCCWYSWLLLFYYNFQVRGVYSRSQDHPGFQVLASASHYWPLENVDGIHELQDTTGDIVEGKVNKGIYLKEEKGVTLLYYGRYNSSCISKPEQCGPEGVTFSFFWKTQGEQSRPIPSAYGGQVISNGFKVCSSGGRGSVELYTRDNSMTWEASFSPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSRDYGESNVNLVIGSEQDQAKCYENGAFDEFIIWERALTPDEIAMYFTAAIGKHALLSSTLPSLFMTSTASPVMPTDAYHPIITNLTEERKTFQSPGVILSYLQNVSLSLPSKSLSEQTALNLTKTFLKAVGEILLLPGWIALSEDSAVVLSLIDTIDTVMGHVSSNLHGSTPQVTVEGSSAMAEFSVAKILPKTVNSSHYRFPAHGQSFIQIPHEAFHRHAWSTVVGLLYHSMHYYLNNIWPAHTKIAEAMHHQDCLLFATSHLISLEVSPPPTLSQNLSGSPLITVHLKHRLTRKQHSEATNSSNRVFVYCAFLDFSSGEGVWSNHGCALTRGNLTYSVCRCTHLTNFAILMQVVPLELARGHQVALSSISYVGCSLSVLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFRLEPGTTPCQVMAVLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRYYYGMGWGFPLLICIISLSFAMDSYGTSNNCWLSLASGAIWAFVAPALFVIVVNIGILIAVTRVISQISADNYKIHGDPSAFKLTAKAVAVLLPILGTSWVFGVLAVNGCAVVFQYMFATLNSLQGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q6QNK2-1; Sequence=Displayed; Name=2; IsoId=Q6QNK2-2; Sequence=VSP_012788, VSP_012789; Name=3; IsoId=Q6QNK2-3; Sequence=VSP_012787, VSP_012790; Name=4; IsoId=Q6QNK2-4; Sequence=VSP_053678

Alternative Sequence

1..481; Missing (in isoform 3); 1..314; Missing (in isoform 2); 62; G -> GASRTHKLTVLPSRNATFVYSNDSAYSNLSATV (in isoform 4); 315..341; QTALNLTKTFLKAVGEILLLPGWIALS -> MEKGTELLVSPSQSGPGGDQPLLVKHR (in isoform 2); 482..491; LITVHLKHRL -> MHRVCFLSFQ (in isoform 3)

3D Structural Models

Turn

564..567; 665..668; 679..681; 721..725

Helix

547..551; 569..591; 600..614; 617..623; 630..661; 672..678; 682..692; 714..720; 726..743; 746..749; 754..768; 771..773; 774..777; 788..806; 813..826

Beta Strand

559..563; 593..597; 627..629; 695..699; 701..706; 708..712; 780..782; 807..809

3D Structure

Electron microscopy (8)

Domain & Motif Annotations

Compositional Bias

861..874; Basic and acidic residues

Domain (CC)

The Stachel sequence (also named stalk) in the C-terminal part of the extracellular domain (ECD) functions as a tethered agonist (PubMed:25533341). In the inactivated receptor, the Stachel sequence (also named stalk) is embedded in the GAIN-B domain, where it adopts a beta-strand conformation (PubMed:35418678, PubMed:35418679). On activation, the Stachel moves into the 7 transmembrane region and adopts a twisted hook-shaped configuration that forms contacts within the receptor, leading to coupling of a G-alpha protein, which activates signaling (PubMed:35418678, PubMed:35418679).; DOMAIN: The N-terminal domain and autocatalytic activity of ADGRD1 at the GPCR proteolysis site (GPS) are not required for G-protein coupling activity.

Domain (FT)

79..276; Pentraxin (PTX); 371..557; GAIN-B

Region

510..557; GPS; 546..554; Stachel; 854..874; Disordered

Protein Families (2)

G-protein coupled receptor 2 family
Adhesion G-protein coupled receptor (ADGR) subfamily

Sequence Similarities

Belongs to the G-protein coupled receptor 2 family. Adhesion G-protein coupled receptor (ADGR) subfamily.

Clinical Relevance1

Antibody (2)

HPA042395 HPA076279

Supporting Publications3

PMID	Title	Abstract
31805958	Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment.	No abstract available
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No abstract available