Protein detail
AGRD1
Adhesion G-protein coupled receptor D1 (G-protein coupled receptor 133) (G-protein coupled receptor PGR25) [Cleaved into: Adhesion G-protein coupled receptor D1, N-terminal fragment (ADGRD1 N-terminal fragment); Adhesion G-protein coupled receptor D1, C-terminal fragment (ADGRD1 C-terminal fragment)]
Entry name AGRD1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 3 | Transmembrane count 7 | Protein classification G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Adhesion G-protein coupled receptor D1 (G-protein coupled receptor 133) (G-protein coupled receptor PGR25) [Cleaved into: Adhesion G-protein coupled receptor D1, N-terminal fragment (ADGRD1 N-terminal fragment); Adhesion G-protein coupled receptor D1, C-terminal fragment (ADGRD1 C-terminal fragment)]
Protein Class (3)
G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- G-protein coupled receptors:Family 2 (B) receptors
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
568..590; Helical; Name=1; 602..623; Helical; Name=2; 633..655; Helical; Name=3; 674..695; Helical; Name=4; 711..732; Helical; Name=5; 758..780; Helical; Name=6; 784..810; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
DKFZp434B1272GPR133PGR25
Gene Description
Adhesion G protein-coupled receptor D1
Chromosome
12
Position
130953907-131141469
Supporting publications (n)
3
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway5
Protein Function (3)
- G-protein coupled receptors:Family 2 (B) receptors
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (5)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence44
Ligand-Receptor Signaling (43)
43 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| gpcr | receptor | GPCRdb | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 5 of 5Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains15
Sequences
Length
874
Mass
96,530
Sequence
MEKLLRLCCWYSWLLLFYYNFQVRGVYSRSQDHPGFQVLASASHYWPLENVDGIHELQDTTGDIVEGKVNKGIYLKEEKGVTLLYYGRYNSSCISKPEQCGPEGVTFSFFWKTQGEQSRPIPSAYGGQVISNGFKVCSSGGRGSVELYTRDNSMTWEASFSPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSRDYGESNVNLVIGSEQDQAKCYENGAFDEFIIWERALTPDEIAMYFTAAIGKHALLSSTLPSLFMTSTASPVMPTDAYHPIITNLTEERKTFQSPGVILSYLQNVSLSLPSKSLSEQTALNLTKTFLKAVGEILLLPGWIALSEDSAVVLSLIDTIDTVMGHVSSNLHGSTPQVTVEGSSAMAEFSVAKILPKTVNSSHYRFPAHGQSFIQIPHEAFHRHAWSTVVGLLYHSMHYYLNNIWPAHTKIAEAMHHQDCLLFATSHLISLEVSPPPTLSQNLSGSPLITVHLKHRLTRKQHSEATNSSNRVFVYCAFLDFSSGEGVWSNHGCALTRGNLTYSVCRCTHLTNFAILMQVVPLELARGHQVALSSISYVGCSLSVLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFRLEPGTTPCQVMAVLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRYYYGMGWGFPLLICIISLSFAMDSYGTSNNCWLSLASGAIWAFVAPALFVIVVNIGILIAVTRVISQISADNYKIHGDPSAFKLTAKAVAVLLPILGTSWVFGVLAVNGCAVVFQYMFATLNSLQGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q6QNK2-1; Sequence=Displayed; Name=2; IsoId=Q6QNK2-2; Sequence=VSP_012788, VSP_012789; Name=3; IsoId=Q6QNK2-3; Sequence=VSP_012787, VSP_012790; Name=4; IsoId=Q6QNK2-4; Sequence=VSP_053678
Alternative Sequence
1..481; Missing (in isoform 3); 1..314; Missing (in isoform 2); 62; G -> GASRTHKLTVLPSRNATFVYSNDSAYSNLSATV (in isoform 4); 315..341; QTALNLTKTFLKAVGEILLLPGWIALS -> MEKGTELLVSPSQSGPGGDQPLLVKHR (in isoform 2); 482..491; LITVHLKHRL -> MHRVCFLSFQ (in isoform 3)
3D Structural Models
Turn
564..567; 665..668; 679..681; 721..725
Helix
547..551; 569..591; 600..614; 617..623; 630..661; 672..678; 682..692; 714..720; 726..743; 746..749; 754..768; 771..773; 774..777; 788..806; 813..826
Beta Strand
559..563; 593..597; 627..629; 695..699; 701..706; 708..712; 780..782; 807..809
3D Structure
Electron microscopy (8)
Domain & Motif Annotations
Compositional Bias
861..874; Basic and acidic residues
Domain (CC)
The Stachel sequence (also named stalk) in the C-terminal part of the extracellular domain (ECD) functions as a tethered agonist (PubMed:25533341). In the inactivated receptor, the Stachel sequence (also named stalk) is embedded in the GAIN-B domain, where it adopts a beta-strand conformation (PubMed:35418678, PubMed:35418679). On activation, the Stachel moves into the 7 transmembrane region and adopts a twisted hook-shaped configuration that forms contacts within the receptor, leading to coupling of a G-alpha protein, which activates signaling (PubMed:35418678, PubMed:35418679).; DOMAIN: The N-terminal domain and autocatalytic activity of ADGRD1 at the GPCR proteolysis site (GPS) are not required for G-protein coupling activity.
Domain (FT)
79..276; Pentraxin (PTX); 371..557; GAIN-B
Region
510..557; GPS; 546..554; Stachel; 854..874; Disordered
Protein Families (2)
- G-protein coupled receptor 2 family
- Adhesion G-protein coupled receptor (ADGR) subfamily
Sequence Similarities
Belongs to the G-protein coupled receptor 2 family. Adhesion G-protein coupled receptor (ADGR) subfamily.
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No abstract available |