Protein detail
PACS1
Phosphofurin acidic cluster sorting protein 1 (PACS-1)
Entry name PACS1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Phosphofurin acidic cluster sorting protein 1 (PACS-1)
Protein Class (4)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
FLJ10209KIAA1175
Gene Description
Phosphofurin acidic cluster sorting protein 1
Chromosome
11
Position
66070272-66244744
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization4
Tissue SpecificretinaCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specifichippocampal CA1-3
Function & Pathway6
Protein Function (3)
- Disease related genes
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (2)
Biological Process (3)
Reactome (7)
- R-hsa-162906 hiv infection
- R-hsa-162909 host interactions of hiv factors
- R-hsa-5663205 infectious disease
- R-hsa-164940 nef mediated downregulation of mhc class i complex cell surface expression
- R-hsa-164938 nef mediates down modulation of cell surface receptors by recruiting them to clathrin adapters
- R-hsa-164952 the role of nef in hiv 1 replication and disease pathogenesis
- R-hsa-9824446 viral infection pathways
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence14
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PACS1 | CSNK2A1 | P68400 | S | 278 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:14633983KEA:14633983SIGNOR:14633983KEA:16977309 |
| PACS1 | PPP2CA | P67775 | S | 278 | dephosphorylation | DEPOD | DEPOD:14633983 |
| PACS1 | PPP2CB | P62714 | S | 278 | dephosphorylation | DEPOD | DEPOD:14633983 |
| PACS1 | CSNK2A2 | P19784 | S | 278 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPKEA | KEA:14633983 |
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CSK21 | P68400 | PACS1 | Q6VY07 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperSPIKE_LC | KEA:14633983ProtMapper:16977309HPRD:16977309PhosphoSite:14633983KEA:16977309ProtMapper:14633983SIGNOR:14633983SPIKE_LC:16977309HPRD:14633983 |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| AP1G1-PACS1-FURIN complex | AP1G1FURINPACS1 | O43747P09958Q6VY07 | 1:1:1 | CompleatCORUM | Compleat:HC1118CORUM:5165 | 11331585 |
| ARHGAP5ATP2A3IQCF1PACS1ZWILCH | Q13017Q6VY07Q8N6M8Q93084Q9H900 | 0:0:0:0:0 | hu.MAP2 | |||
| PACS1WDR37 | Q6VY07Q9Y2I8 | 0:0 | hu.MAPhu.MAP2 |
Sequence, Structure & Domains10
Sequences
Length
963
Mass
104,898
Sequence
MAERGGAGGGPGGAGGGSGQRGSGVAQSPQQPPPQQQQQQPPQQPTPPKLAQATSSSSSTSAAAASSSSSSTSTSMAVAVASGSAPPGGPGPGRTPAPVQMNLYATWEVDRSSSSCVPRLFSLTLKKLVMLKEMDKDLNSVVIAVKLQGSKRILRSNEIVLPASGLVETELQLTFSLQYPHFLKRDANKLQIMLQRRKRYKNRTILGYKTLAVGLINMAEVMQHPNEGALVLGLHSNVKDVSVPVAEIKIYSLSSQPIDHEGIKSKLSDRSPDIDNYSEEEEESFSSEQEGSDDPLHGQDLFYEDEDLRKVKKTRRKLTSTSAITRQPNIKQKFVALLKRFKVSDEVGFGLEHVSREQIREVEEDLDELYDSLEMYNPSDSGPEMEETESILSTPKPKLKPFFEGMSQSSSQTEIGSLNSKGSLGKDTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSERTNSSDSERSPDLGHSTQIPRKVVYDQLNQILVSDAALPENVILVNTTDWQGQYVAELLQDQRKPVVCTCSTVEVQAVLSALLTRIQRYCNCNSSMPRPVKVAAVGGQSYLSSILRFFVKSLANKTSDWLGYMRFLIIPLGSHPVAKYLGSVDSKYSSSFLDSGWRDLFSRSEPPVSEQLDVAGRVMQYVNGAATTHQLPVAEAMLTCRHKFPDEDSYQKFIPFIGVVKVGLVEDSPSTAGDGDDSPVVSLTVPSTSPPSSSGLSRDATATPPSSPSMSSALAIVGSPNSPYGDVIGLQVDYWLGHPGERRREGDKRDASSKNTLKSVFRSVQVSRLPHSGEAQLSGTMAMTVVTKEKNKKVPTIFLSKKPREKEVDSKSQVIEGISRLICSAKQQQTMLRVSIDGVEWSDIKFFQLAAQWPTHVKHFPVGLFSGSKAT
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6VY07-1; Sequence=Displayed; Name=2; IsoId=Q6VY07-2; Sequence=VSP_011557
Alternative Sequence
917..963; AKQQQTMLRVSIDGVEWSDIKFFQLAAQWPTHVKHFPVGLFSGSKAT -> SPSLGPSLGPDPSSQPGFPPAGSFPPCHLPLTNPGSEPLIPDRPCSQEWLRTQGPSPALCTPQPGHLRPTAPLELFSCPLTPSQKFLHRTSF (in isoform 2)
Domain & Motif Annotations
Compositional Bias
1..22; Gly residues; 53..72; Low complexity; 262..273; Basic and acidic residues; 276..293; Acidic residues; 406..428; Polar residues; 483..496; Polar residues; 770..804; Low complexity
Coiled Coil
353..377
Region
1..72; Disordered; 78..97; Disordered; 168..175; Involved in binding to AP-1; 262..299; Disordered; 377..428; Disordered; 476..542; Disordered; 760..804; Disordered
Protein Families
PACS family
Sequence Similarities
Belongs to the PACS family.
Clinical Relevance5
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No abstract available |
| 40311616 | Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer. | No abstract available |