Protein detail
S36A4
Neutral amino acid uniporter 4 (Solute carrier family 36 member 4)
Entry name S36A4 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 2 | Transmembrane count 10 | Protein classification Metabolic proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Neutral amino acid uniporter 4 (Solute carrier family 36 member 4)
Protein Class (3)
Metabolic proteinsPredicted membrane proteinsTransporters
Protein Function
Transporters:Electrochemical Potential-driven transporters
Transmembrane
87..107; Helical; 154..174; Helical; 206..226; Helical; 231..251; Helical; 273..293; Helical; 309..329; Helical; 358..378; Helical; 389..409; Helical; 414..434; Helical; 456..476; Helical
Transmembrane Count
10
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
FLJ38932PAT4
Gene Description
Solute carrier family 36 member 4
Chromosome
11
Position
93144174-93197991
Supporting publications (n)
2
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificintestineCell SpecificEnterocytesSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificnon-classical monocyteBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function
Transporters:Electrochemical Potential-driven transporters
Cellular Component (3)
Molecular Function (4)
Biological Process (3)
Reactome (5)
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence21
Ligand-Receptor Signaling (19)
19 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| transporter | transporter | Surfaceome | Yes | ||||
| solute_carrier | transporter | Almen2009 | Yes | ||||
| slc36 | transporter | Surfaceome | Yes | ||||
| apc | transporter | Surfaceome | Yes | ||||
| slc | transporter | Surfaceome | Yes | ||||
| transporter | transporter | OmniPath | Yes |
Page 1 of 2Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| RAB12 | Q6IQ22 | S36A4 | Q6YBV0 | Yes | Yes | SIGNOR | SIGNOR:23478338 |
Sequence, Structure & Domains
Sequences
Length
504
Mass
56,157
Sequence
MEAAATPAAAGAARREELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCLRFKKSTLGYSDTVSFAMEVSPWSCLQKQAAWGRSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLESKVFISNSTNSSNPCERRSVDLRIYMLCFLPFIILLVFIRELKNLFVLSFLANVSMAVSLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMKESKRFPQALNIGMGIVTTLYVTLATLGYMCFHDEIKGSITLNLPQDVWLYQSVKILYSFGIFVTYSIQFYVPAEIIIPGITSKFHTKWKQICEFGIRSFLVSITCAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILTFSKEHYNIWMVLKNISIAFTGVVGFLLGTYITVEEIIYPTPKVVAGTPQSPFLNLNSTCLTSGLK
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6YBV0-1; Sequence=Displayed; Name=2; IsoId=Q6YBV0-2; Sequence=VSP_028959
Alternative Sequence
1..135; Missing (in isoform 2)
Domain & Motif Annotations
Protein Families
Amino acid/polyamine transporter 2 family
Sequence Similarities
Belongs to the amino acid/polyamine transporter 2 family.
Clinical Relevance
Antibody
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 37646133 | ICAM-1-decorated extracellular vesicles loaded with miR-146a and Glut1 drive immunomodulation and hinder tumor progression in a murine model of breast cancer. | Engineered extracellular vesicles (EVs) decorated with ICAM-1 ligands and loaded with miR-146a and |
| 38673823 | Altered Glycolysis, Mitochondrial Biogenesis, Autophagy and Apoptosis in Peritoneal Endometriosis in Adolescents. | Samples of plasma and peritoneal fluid exosomes, endometrioid foci and non-affected peritoneum were tested for estrogen receptor (Erα/β), hexokinase (Hex2), pyruvate dehydrogenase kinase (PDK1), glucose transporter (Glut1), monocarboxylate transporters (MCT1 and MCT2), optic atrophy 1 (OPA1, mitochondrial fusion protein), dynamin-related protein 1 (DRP1, mitochondrial fission protein), Bax, Bcl2, Beclin1, Bnip3, P38 mitogen-activated protein kinase (MAPK), hypoxia-inducible factor 1 (Hif-1α), mitochondrial voltage-dependent anion channel (VDAC) and transforming growth factor (TGFβ) proteins as markers of estrogen signaling, glycolysis rates, mitochondrial biogenesis and damage, apoptosis and autophagy (Western-Blot and PCR). |