Protein detail

S36A4

Neutral amino acid uniporter 4 (Solute carrier family 36 member 4)

Entry name S36A4	UniProt ID Q6YBV0	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count 10	Protein classification Metabolic proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Neutral amino acid uniporter 4 (Solute carrier family 36 member 4)

Protein Class (3)

Metabolic proteinsPredicted membrane proteinsTransporters

Protein Function

Transporters:Electrochemical Potential-driven transporters

Transmembrane

87..107; Helical; 154..174; Helical; 206..226; Helical; 231..251; Helical; 273..293; Helical; 309..329; Helical; 358..378; Helical; 389..409; Helical; 414..434; Helical; 456..476; Helical

Transmembrane Count

Ensembl

ENSG00000180773

Entrez Gene Symbol

SLC36A4

Gene Synonym (2)

FLJ38932PAT4

Gene Description

Solute carrier family 36 member 4

Chromosome

Position

93144174-93197991

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization5

Tissue SpecificintestineCell SpecificEnterocytesSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificnon-classical monocyteBlood Lineage Specificdendritic cells

Function & Pathway7

Protein Function

Transporters:Electrochemical Potential-driven transporters

Cellular Component (3)

Molecular Function (4)

Biological Process (3)

KEGG (2)

Reactome (5)

Mediation Categories (2)

Fusion and delivery mediationMetabolism mediation

Relations & Evidence21

Ligand-Receptor Signaling (19)

19 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	OmniPath	No	Yes	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transporter	transporter	Surfaceome	No	Yes	No	No	No
solute_carrier	transporter	Almen2009	No	Yes	No	No	No
slc36	transporter	Surfaceome	No	Yes	No	No	No
apc	transporter	Surfaceome	No	Yes	No	No	No
slc	transporter	Surfaceome	No	Yes	No	No	No
transporter	transporter	OmniPath	No	Yes	No	No	No

Page 1 of 2Next

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
RAB12	Q6IQ22	S36A4	Q6YBV0	Yes	No	Yes	SIGNOR	SIGNOR:23478338

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryFlow cytometryMORPH	2	32854315 37563857

Sequence, Structure & Domains7

Sequences

Length

504

Mass

56,157

Sequence

MEAAATPAAAGAARREELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCLRFKKSTLGYSDTVSFAMEVSPWSCLQKQAAWGRSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLESKVFISNSTNSSNPCERRSVDLRIYMLCFLPFIILLVFIRELKNLFVLSFLANVSMAVSLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTAVFAFEGIGVVLPLENQMKESKRFPQALNIGMGIVTTLYVTLATLGYMCFHDEIKGSITLNLPQDVWLYQSVKILYSFGIFVTYSIQFYVPAEIIIPGITSKFHTKWKQICEFGIRSFLVSITCAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILTFSKEHYNIWMVLKNISIAFTGVVGFLLGTYITVEEIIYPTPKVVAGTPQSPFLNLNSTCLTSGLK

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6YBV0-1; Sequence=Displayed; Name=2; IsoId=Q6YBV0-2; Sequence=VSP_028959

Alternative Sequence

1..135; Missing (in isoform 2)

Domain & Motif Annotations

Protein Families

Amino acid/polyamine transporter 2 family

Sequence Similarities

Belongs to the amino acid/polyamine transporter 2 family.

Clinical Relevance1

Antibody

HPA017887

Supporting Publications2

PMID	Title	Abstract
37646133	ICAM-1-decorated extracellular vesicles loaded with miR-146a and Glut1 drive immunomodulation and hinder tumor progression in a murine model of breast cancer.	Engineered extracellular vesicles (EVs) decorated with ICAM-1 ligands and loaded with miR-146a and
38673823	Altered Glycolysis, Mitochondrial Biogenesis, Autophagy and Apoptosis in Peritoneal Endometriosis in Adolescents.	Samples of plasma and peritoneal fluid exosomes, endometrioid foci and non-affected peritoneum were tested for estrogen receptor (Erα/β), hexokinase (Hex2), pyruvate dehydrogenase kinase (PDK1), glucose transporter (Glut1), monocarboxylate transporters (MCT1 and MCT2), optic atrophy 1 (OPA1, mitochondrial fusion protein), dynamin-related protein 1 (DRP1, mitochondrial fission protein), Bax, Bcl2, Beclin1, Bnip3, P38 mitogen-activated protein kinase (MAPK), hypoxia-inducible factor 1 (Hif-1α), mitochondrial voltage-dependent anion channel (VDAC) and transforming growth factor (TGFβ) proteins as markers of estrogen signaling, glycolysis rates, mitochondrial biogenesis and damage, apoptosis and autophagy (Western-Blot and PCR).