Protein detail
CX6B2
Cytochrome c oxidase subunit 6B2 (Cancer/testis antigen 59) (CT59) (Cytochrome c oxidase subunit VIb isoform 2) (COX VIb-2) (Cytochrome c oxidase subunit VIb, testis-specific isoform)
Entry name CX6B2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cytochrome c oxidase subunit 6B2 (Cancer/testis antigen 59) (CT59) (Cytochrome c oxidase subunit VIb isoform 2) (COX VIb-2) (Cytochrome c oxidase subunit VIb, testis-specific isoform)
Protein Function (2)
- Transporters:Primary Active Transporters
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificBreast lactating cells
Function & Pathway
Protein Function (2)
- Transporters:Primary Active Transporters
- Predicted intracellular proteins
Cellular Component (4)
Molecular Function
Biological Process (3)
KEGG (13)
- hsa00190 Oxidative phosphorylation
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04260 Cardiac muscle contraction
- KEGG:hsa04714 Thermogenesis
- KEGG:hsa04932 Non-alcoholic fatty liver disease
- KEGG:hsa05010 Alzheimer disease
- KEGG:hsa05012 Parkinson disease
- KEGG:hsa05014 Amyotrophic lateral sclerosis
- KEGG:hsa05016 Huntington disease
- KEGG:hsa05020 Prion disease
Page 1 of 2
Reactome (9)
- R-hsa-1428517 aerobic respiration and respiratory electron transport
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-9711123 cellular response to chemical stress
- R-hsa-9864848 complex iv assembly
- R-hsa-9707564 cytoprotection by hmox1
- R-hsa-611105 respiratory electron transport
- R-hsa-73857 rna polymerase ii transcription
- R-hsa-5628897 tp53 regulates metabolic genes
- R-hsa-3700989 transcriptional regulation by tp53
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence6
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (1)
1 record.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Cytochrome c oxidase (complex IV) | COX4I1COX4I2COX5ACOX5BCOX6A1COX6A2COX6B1COX6B2COX7CMT-CO1MT-CO2MT-CO3 | P00395P00403P00414P10606P12074P13073P14854P15954P20674Q02221Q6YFQ2Q96KJ9 | 1:1:1:1:1:1:1:1:1:1:1:1 | Compleat | Compleat:HC1401 | 7851399 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 39363010 |
Sequence, Structure & Domains
Sequences
Length
88
Mass
10,529
Sequence
MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
Domain & Motif Annotations
Motif
32..42; Cx9C motif; 56..67; Cx10C motif
Domain (FT)
29..75; CHCH
Region
1..22; Disordered
Protein Families
Cytochrome c oxidase subunit 6B family
Sequence Similarities
Belongs to the cytochrome c oxidase subunit 6B family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 30915084 | Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton. | No related sentences available |