Protein detail
ARK2C
E3 ubiquitin-protein ligase ARK2C (EC 2.3.2.27) (RING finger protein 165) (RNF165)
Entry name ARK2C | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification EnzymesPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
E3 ubiquitin-protein ligase ARK2C (EC 2.3.2.27) (RING finger protein 165) (RNF165)
Protein Class (2)
EnzymesPredicted intracellular proteins
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
Ark2CARKL2lncAMPCRNF111L2
Gene Description
Ring finger protein 165
Chromosome
18
Position
46326809-46463140
Supporting publications (n)
1
EVMP confidence score
0.53
Function & Pathway
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Canonical Pathways (3)
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Other mediation
Relations & Evidence147
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (136)
136 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| COMPLEX:P62979_Q96B02 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P0CG48_Q9NR09 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P62979_Q96LR5 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P0CG47_P49459 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:O00762_P0CG48 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P0CG47_Q969T4 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P0CG47_Q5JXB2 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P62979_Q16763 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P0CG47_Q712K3 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P0CG48_Q7Z7E8 | ARK2C | Q6ZSG1 | Yes | Yes | SIGNOR | SIGNOR:34199813 |
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Ub:RING_E3 | ARK2CUBB | P0CG47Q6ZSG1 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | ARK2CUBC | P0CG48Q6ZSG1 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | ARK2CRPS27A | P62979Q6ZSG1 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | ARK2CUBA52 | P62987Q6ZSG1 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| ARK2CUBCUBE2NUBE2V2 | P0CG48P61088Q15819Q6ZSG1 | 1:1:1:1 | PDB | PDB:9n1f | ||
| ARK2C | Q6ZSG1 | 2 | PDB | PDB:5d0iPDB:7r70 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 21630462 |
Sequence, Structure & Domains
Sequences
Length
346
Mass
39,526
Sequence
MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAPDFPLAHPVQSQPGLSAHMAPAHQHSGALHQSLTPLPTLQFQDVTGPSFLPQALHQQYLLQQQLLEAQHRRLVSHPRRSQERVSVHPHRLHPSFDFGQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6ZSG1-1; Sequence=Displayed; Name=2; IsoId=Q6ZSG1-2; Sequence=VSP_045128
Alternative Sequence
1..192; Missing (in isoform 2)
3D Structural Models
Turn
295..297; 332..334
Helix
261..264; 318..328
Beta Strand
265..269; 299..305; 306..309; 315..317
3D Structure
X-ray crystallography (8)
Domain & Motif Annotations
Compositional Bias
275..284; Basic and acidic residues
Zinc Finger
294..335; RING-type; atypical
Domain (CC)
The RING-type zinc finger mediates the E3 ubiquitin-protein ligase activity and binds directly to free ubiquitin (PubMed:26656854). Non-covalent ubiquitin-binding stabilizes the ubiquitin-conjugating enzyme E2 (donor ubiquitin) in the 'closed' conformation and stimulates ubiquitin transfer (PubMed:26656854).
Region
23..76; Disordered; 266..268; Ubiquitin binding; 267..288; Disordered; 309..313; Ubiquitin binding
Protein Families
Arkadia family
Sequence Similarities
Belongs to the Arkadia family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 39363010 | Proteomic analysis of plasma-derived extracellular vesicles: pre- and postprandial comparisons. | No related sentences available |