Protein detail
TGRM2
TOG array regulator of axonemal microtubules protein 2 (Crescerin-2)
Entry name TGRM2 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
TOG array regulator of axonemal microtubules protein 2 (Crescerin-2)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
Crescerin-2FAM179AFLJ43249LOC165186
Gene Description
TOG array regulator of axonemal microtubules 2
Chromosome
2
Position
28956611-29052230
Supporting publications (n)
2
EVMP confidence score
0.28
Fluorescence & Localization
Tissue SpecificovaryCell SpecificBrain excitatory neuronsSingle-Nuclei Brain SpecificLAMP5-LHX6 and Chandelier
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence3
Ligand-Receptor Signaling (2)
2 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 36750568 |
Sequence, Structure & Domains
Sequences
Length
1,019
Mass
111,153
Sequence
MGTRDDVPEAKVLVPVAVYCGSIPRTSAGPRVLPPGSINSSLPHGEGSLQPEPRALLNNEEPSQLLRGLGQLGGLKLDTPSKGWQARNGHPRNLRALSLGDQPLVLLPSPESEANSVARDTIQIKDKLKKRRLSEGLAASSRASLDPGGGPQGVPLHSTIPRATSQRLLRVPRPMPLIQSIPTTPEASGVKEKGLDLPGSIPGPHELRPGAQEAQISWQYLHCNDEKMQKSLGAIVIPPIPKARTVAATPSRVPGSLPSPLPPGQGVLTGLRAPRTRLARGSGPREKTPASLEPKPLASPIRDRPAAAKKPALPFSQSAPTLTAFSFDCAREACPPLKEEDQKEIGTKIQVTISKSAREKMQLKQMKEMELLRRLEEPRTGQELTSQCLGSQRAFMKEGLLPLRGSGTLSVPTRLSGPCRNDVSIILRKWASRASLPSIPISRQEPRFARHASANSLPAVLTLGSPEWEEEEEMDLRACKELRPFSNPELGLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGKLHDVCLVVTGEVTNLRSKVSHLAISTLGDLFQALKKNMDQEAEEIARCLLQKMADTNEFIQRAAGQSLRAMVENVTLARSLVVLTSAGVYHRNPLIRKYAAEHLSAVLEQIGAEKLLSGTRDSTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANTKFDAFLKQSLPSYDLQKVMAAIKQQGIEDNDELPSAKGRKVLRSLVVCENGLPIKEGLSCNGPRLVGLRSTLQGRGEMVEQLRELTRLLEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMIPLLRESLHPMLLSIIITVADNLNSKNSGIYAAAVAVLDAMVESLDNLCLLPALAGRVRFLSGRAVLDVTDRLAVLVASVYPRKPQAVERHVLPILWHFLNTATRNGTLPGPSGNIRGVVCRLSRSLQEHMGSRLLDFAASQPKHVLKTLQELLDSESLGGSRKATDRGVAPDSKTTGSSYPFQLD
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q6ZUX3-1; Sequence=Displayed; Name=2; IsoId=Q6ZUX3-2; Sequence=VSP_032492; Name=3; IsoId=Q6ZUX3-3; Sequence=VSP_032491, VSP_032493, VSP_032494, VSP_032495
Alternative Sequence
1..702; Missing (in isoform 3); 1..473; Missing (in isoform 2); 703..710; VMAAIKQQ -> MLCVYFFK (in isoform 3); 908..949; VLVASVYPRKPQAVERHVLPILWHFLNTATRNGTLPGPSGNI -> GEHPQPHPTPSPGRFLFSPGLWLNHSPSYLRPEIIPPNHLKF (in isoform 3); 950..1019; Missing (in isoform 3)
Domain & Motif Annotations
Compositional Bias
1007..1019; Polar residues
Region
28..54; Disordered; 131..158; Disordered; 249..311; Disordered; 991..1019; Disordered
Protein Families
Crescerin family
Sequence Similarities
Belongs to the Crescerin family.
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |
| 38795909 | Proteomic profile of tissue-derived extracellular vesicles from benign odontogenic lesions. | No related sentences available |