Protein detail
LHPL2
LHFPL tetraspan subfamily member 2 protein (Lipoma HMGIC fusion partner-like 2 protein)
Entry name LHPL2 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 10 | Transmembrane count 4 | Protein classification Predicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
LHFPL tetraspan subfamily member 2 protein (Lipoma HMGIC fusion partner-like 2 protein)
Protein Class
Predicted membrane proteins
Transmembrane
11..31; Helical; 102..122; Helical; 132..152; Helical; 181..201; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym
KIAA0206
Gene Description
LHFPL tetraspan subfamily member 2
Chromosome
5
Position
78485215-78770021
Supporting publications (n)
10
EVMP confidence score
0.63
Fluorescence & Localization
Tissue Specificadipose tissueCell SpecificBergmann gliaSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Reactome (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence13
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| transmembrane | transmembrane_predicted | Phobius | Yes |
Page 2 of 2Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry | 13 | 38113368345995103330447832854315388910773161715841128489413079683180595834576246390017003920704741068253 |
Sequence, Structure & Domains
Sequences
Length
228
Mass
24,486
Sequence
MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL
Domain & Motif Annotations
Protein Families
LHFP family
Sequence Similarities
Belongs to the LHFP family.
Supporting Publications10
| PMID | Title | Related sentences |
|---|---|---|
| 32230970 | Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles. | No related sentences available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 34576246 | Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators. | No related sentences available |
| 36064647 | Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells. | No related sentences available |
| 37204515 | Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma. | No related sentences available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 37926756 | Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |