Protein detail
RAPH1
Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 18 protein) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1)
Entry name RAPH1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 5 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 18 protein) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ALS2CR18ALS2CR9KIAA1681
Gene Description
Ras association (RalGDS/AF-6) and pleckstrin homology domains 1
Chromosome
2
Position
203394345-203535335
Supporting publications (n)
5
EVMP confidence score
0.50
Fluorescence & Localization5
Tissue SpecificprostateCell SpecificAdipocytesSecretome LocationIntracellular and membraneSecretome FunctionReceptor
Function & Pathway4
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function
Mediation Categories
Other mediation
Relations & Evidence16
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RAPH1 | ABL1 | P00519 | Y | 426 | phosphorylation | dbPTMPhosphoSiteSIGNOR | SIGNOR:20417104dbPTM:20417104 |
| RAPH1 | ABL1 | P00519 | Y | 456 | phosphorylation | dbPTMPhosphoSiteSIGNOR | SIGNOR:20417104dbPTM:20417104 |
| RAPH1 | ABL1 | P00519 | Y | 1,226 | phosphorylation | dbPTMPhosphoSiteSIGNOR | SIGNOR:20417104dbPTM:20417104 |
| RAPH1 | ABL1 | P00519 | Y | 513 | phosphorylation | PhosphoSiteSIGNOR | SIGNOR:20417104 |
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ABL1 | P00519 | RAPH1 | Q70E73 | Yes | Yes | No | iPTMnetSIGNORProtMapperdbPTMSIGNOR_ProtMapperSPIKESPIKE_LC | ProtMapper:20417104SPIKE:20417104SIGNOR:20417104SPIKE_LC:20841568dbPTM:20417104SPIKE:20841568SPIKE_LC:20417104 |
| RAPH1 | Q70E73 | EVL | Q9UI08 | Yes | Yes | No | SIGNOR | SIGNOR:20417104 |
| RAPH1 | Q70E73 | ENAH | Q8N8S7 | Yes | Yes | No | SIGNOR | SIGNOR:20417104 |
| RAPH1 | Q70E73 | VASP | P50552 | Yes | Yes | No | SIGNORBioGRID | SIGNOR:20417104BioGRID:15469845 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryMass spectrometry [MALDI TOF] | 1 | 40326690 |
Sequence, Structure & Domains13
Sequences
Length
1,250
Mass
135,256
Sequence
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQKLPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTKPLVTNQHRRTASAGTVSDAEVHSISNSSHSSITSAASSMDSLDIDKVTRPQELDLTHQGQPITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSSSSIPESQSNHSNQSDSGVSDTQPAGHVRSQSIVSSVFSEAWKRGTQLEESSKARMESMNRPYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMFVKYSTITRLQNASQHSGALFKPPTPPVMQSQSVKPQILVPPNGVVPPPPPPPPPPTPGSAMAQLKPAPCAPSLPQFSAPPPPLKIHQVQHITQVAPPTPPPPPPIPAPLPPQAPPKPLVTIPAPTSTKTVAPVVTQAAPPTPTPPVPPAKKQPAFPASYIPPSPPTPPVPVPPPTLPKQQSFCAKPPPSPLSPVPSVVKQIASQFPPPPTPPAMESQPLKPVPANVAPQSPPAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGGKKPPPTPQRNSSIKSSSGAEHPEPKRPSVDSLVSKFTPPAESGSPSKETLPPPAAPPKPGKLNLSGVNLPGVLQQGCVSAKAPVLSGRGKDSVVEFPSPPSDSDFPPPPPETELPLPPIEIPAVFSGNTSPKVAVVNPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISEQPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDMALPPPPPELLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW
Alternative Products
Event=Alternative splicing; Named isoforms=9; Name=RMO1-RAPH1; Synonyms=Lamellipodin, RAPH1; IsoId=Q70E73-10; Sequence=Displayed; Name=RMO1; IsoId=Q70E73-2; Sequence=VSP_035788, VSP_035789; Name=RMO1a; IsoId=Q70E73-3; Sequence=VSP_035784, VSP_035788, VSP_035789; Name=RMO1b; IsoId=Q70E73-4; Sequence=VSP_035786, VSP_035788, VSP_035789; Name=RMO1c; IsoId=Q70E73-5; Sequence=VSP_035787; Name=RMO1ab; Synonyms=Lamellipodin-S, Lpd-S; IsoId=Q70E73-6; Sequence=VSP_035785, VSP_035788, VSP_035789; Name=RMO1ac; IsoId=Q70E73-7; Sequence=VSP_035784, VSP_035787; Name=RMO1bc; IsoId=Q70E73-8; Sequence=VSP_035786, VSP_035787; Name=RMO1abc; IsoId=Q70E73-9; Sequence=VSP_035785, VSP_035787
Alternative Sequence
244; E -> EHAISLRCSSKQAKRHIDFTEEQAELTP (in isoform RMO1a and isoform RMO1ac); 244; E -> EHAISLRCSSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTK (in isoform RMO1ab and isoform RMO1abc); 244; E -> EHSYLDRETSLLLRNIAGKPSHLLTK (in isoform RMO1b and isoform RMO1bc); 593..1250; Missing (in isoform RMO1c, isoform RMO1ac, isoform RMO1bc and isoform RMO1abc); 593..597; ARMES -> VTASF (in isoform RMO1, isoform RMO1a, isoform RMO1b and isoform RMO1ab); 598..1250; Missing (in isoform RMO1, isoform RMO1a, isoform RMO1b and isoform RMO1ab)
3D Structural Models
Helix
255..264; 293..304; 319..321; 333..337; 354..356; 358..361; 363..365; 378..389; 436..438; 445..447; 456..459; 490..505; 507..516
Beta Strand
270..276; 282..288; 312..318; 323..326; 348..352; 390..393; 400..406; 413..421; 424..427; 429..433; 440..443; 449..455; 463..465; 467..471; 483..486
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
1..23; Acidic residues; 202..217; Low complexity; 535..551; Low complexity; 552..570; Polar residues; 588..597; Basic and acidic residues; 624..650; Pro residues; 651..662; Low complexity; 707..721; Pro residues; 760..781; Pro residues; 791..802; Low complexity; 803..814; Pro residues; 823..840; Pro residues; 909..947; Pro residues; 948..968; Low complexity; 976..986; Polar residues; 1018..1027; Pro residues; 1065..1088; Pro residues; 1131..1144; Polar residues; 1151..1161; Polar residues; 1238..1250; Basic and acidic residues
Domain (FT)
269..355; Ras-associating; 396..505; PH
Region
1..26; Disordered; 179..217; Disordered; 535..570; Disordered; 588..663; Disordered; 675..1036; Disordered; 1050..1162; Disordered; 1176..1250; Disordered
Protein Families
MRL family
Sequence Similarities
Belongs to the MRL family.
Clinical Relevance4
Supporting Publications5
| PMID | Title | Abstract |
|---|---|---|
| 30451371 | Extracellular Vesicles from Neurosurgical Aspirates Identifies Chaperonin Containing TCP1 Subunit 6A as a Potential Glioblastoma Biomarker with Prognostic Significance. | No abstract available |
| 31320591 | Exosomes regulate neurogenesis and circuit assembly. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |
| 41216884 | Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation. | No abstract available |