Protein detail

GRP2

RAS guanyl-releasing protein 2 (Calcium and DAG-regulated guanine nucleotide exchange factor I) (CalDAG-GEFI) (Cdc25-like protein) (hCDC25L) (F25B3.3 kinase-like protein)

Entry name GRP2	UniProt ID Q7LDG7	EVMP confidence score 0.50
Supporting publications (n) 3	Transmembrane count	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsRAS pathway related proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

RAS guanyl-releasing protein 2 (Calcium and DAG-regulated guanine nucleotide exchange factor I) (CalDAG-GEFI) (Cdc25-like protein) (hCDC25L) (F25B3.3 kinase-like protein)

Protein Class (5)

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsRAS pathway related proteins

Protein Function (4)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Cardiovascular diseases:Hematologic diseases
RAS pathway related proteins

Ensembl

ENSG00000068831

Entrez Gene Symbol

RASGRP2

Gene Synonym

CALDAG-GEFI

Gene Description

RAS guanyl releasing protein 2

Chromosome

Position

64726911-64745456

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Cell SpecificAdrenal medulla cellsSingle-Nuclei Brain Specificependymal cell

Function & Pathway7

Protein Function (4)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Cardiovascular diseases:Hematologic diseases
RAS pathway related proteins

Cellular Component (5)

Molecular Function (4)

Biological Process (3)

KEGG (6)

Reactome (12)

Page 1 of 2

Mediation Categories (2)

Immune mediationReceptor-signaling mediation

Relations & Evidence12

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
RASGRP2	PRKACA	P17612	S	587	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
RASGRP2	MAPK1	P28482	S	394	phosphorylation	RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:27107697

Ligand-Receptor Signaling (7)

7 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
MK01	P28482	GRP2	Q7LDG7	Yes	No	Yes	Sparser_ProtMapperiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperREACH_ProtMapper	SIGNOR:27107697 ProtMapper:27107697

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	RAP1B RASGRP2	P61224 Q7LDG7	8:8	PDB	PDB:6axf

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometrySmall R sequencing (Illumi HiSeq 2000 (Solexa)	4	32938681 31753726 38071653 36028467

Sequence, Structure & Domains15

Sequences

Length

609

Mass

69,248

Sequence

MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=CalDAG-GEFI, CalDAG-GEFIa; IsoId=Q7LDG7-1; Sequence=Displayed; Name=2; Synonyms=RasGRP2; IsoId=Q7LDG7-2; Sequence=VSP_030574; Name=3; Synonyms=CalDAG-GEFIb; IsoId=Q7LDG7-3; Sequence=VSP_030575, VSP_030576; Name=4; IsoId=Q7LDG7-4; Sequence=VSP_054132

Alternative Sequence

1; M -> MGTQRLCGRGTQGWPGSSEQHVQEATSSAGLHSGVDELGVRSEPGGRLPERSLGPAHPAPAAM (in isoform 2); 125; P -> CVGAEHRGLGGHSVSYTICA (in isoform 3); 126..609; Missing (in isoform 3); 590; P -> PA (in isoform 4)

3D Structural Models

Turn

283..286; 455..457

Helix

13..22; 33..42; 43..45; 49..65; 69..85; 87..92; 94..110; 116..118; 129..132; 145..150; 155..170; 175..184; 191..212; 217..236; 240..250; 253..256; 259..263; 267..279; 287..294; 306..317; 331..346; 347..349; 358..369; 374..384; 420..437; 448..454; 464..467; 477..486

Beta Strand

137..140; 320..323; 490..492

3D Structure

NMR spectroscopy (1); X-ray crystallography (1)

Domain & Motif Annotations

Zinc Finger

498..548; Phorbol-ester/DAG-type

Domain (CC)

The N-terminal Ras-GEF domain mediates association with F-actin.

Domain (FT)

4..126; N-terminal Ras-GEF; 154..387; Ras-GEF; 426..461; EF-hand 1; 455..490; EF-hand 2

Region

382..406; Disordered; 557..592; Disordered

Protein Families

RASGRP family

Sequence Similarities

Belongs to the RASGRP family.

Clinical Relevance2

Disease Involvement

Disease variant

Antibody (2)

HPA015635 HPA015667

Supporting Publications3

PMID	Title	Abstract
23161513	Proteomic analysis of exosomes from mutant KRAS colon cancer cells identifies intercellular transfer of mutant KRAS.	Exosomes from mutant KRAS cells contain many tumor-promoting proteins, including KRAS, EGFR, SRC family kinases, and integrins.
28369848	End stage renal disease-induced hypercalcemia may promote aortic valve calcification via Annexin VI enrichment of valve interstitial cell derived-matrix vesicles.	No abstract available
28396511	Database-augmented Mass Spectrometry Analysis of Exosomes Identifies Claudin 3 as a Putative Prostate Cancer Biomarker.	No abstract available