Protein detail
GRP2
RAS guanyl-releasing protein 2 (Calcium and DAG-regulated guanine nucleotide exchange factor I) (CalDAG-GEFI) (Cdc25-like protein) (hCDC25L) (F25B3.3 kinase-like protein)
Entry name GRP2 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 3 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsRAS pathway related proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
RAS guanyl-releasing protein 2 (Calcium and DAG-regulated guanine nucleotide exchange factor I) (CalDAG-GEFI) (Cdc25-like protein) (hCDC25L) (F25B3.3 kinase-like protein)
Protein Class (5)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsRAS pathway related proteins
Protein Function (4)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- RAS pathway related proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
CALDAG-GEFI
Gene Description
RAS guanyl releasing protein 2
Chromosome
11
Position
64726911-64745456
Supporting publications (n)
3
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificAdrenal medulla cellsSingle-Nuclei Brain Specificependymal cell
Function & Pathway
Protein Function (4)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- RAS pathway related proteins
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
KEGG (6)
Reactome (12)
- R-hsa-1280218 adaptive immune system
- R-hsa-114508 effects of pip2 hydrolysis
- R-hsa-2871837 fceri mediated nf kb activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-416476 g alpha q signalling events
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-354192 integrin signaling
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-76009 platelet aggregation plug formation
Page 1 of 2
Mediation Categories (2)
Immune mediationReceptor-signaling mediation
Relations & Evidence12
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RASGRP2 | PRKACA | P17612 | S | 587 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| RASGRP2 | MAPK1 | P28482 | S | 394 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:27107697 |
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MK01 | P28482 | GRP2 | Q7LDG7 | Yes | Yes | Sparser_ProtMapperiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperREACH_ProtMapper | SIGNOR:27107697ProtMapper:27107697 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
Sequence, Structure & Domains
Sequences
Length
609
Mass
69,248
Sequence
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=CalDAG-GEFI, CalDAG-GEFIa; IsoId=Q7LDG7-1; Sequence=Displayed; Name=2; Synonyms=RasGRP2; IsoId=Q7LDG7-2; Sequence=VSP_030574; Name=3; Synonyms=CalDAG-GEFIb; IsoId=Q7LDG7-3; Sequence=VSP_030575, VSP_030576; Name=4; IsoId=Q7LDG7-4; Sequence=VSP_054132
Alternative Sequence
1; M -> MGTQRLCGRGTQGWPGSSEQHVQEATSSAGLHSGVDELGVRSEPGGRLPERSLGPAHPAPAAM (in isoform 2); 125; P -> CVGAEHRGLGGHSVSYTICA (in isoform 3); 126..609; Missing (in isoform 3); 590; P -> PA (in isoform 4)
3D Structural Models
Turn
283..286; 455..457
Helix
13..22; 33..42; 43..45; 49..65; 69..85; 87..92; 94..110; 116..118; 129..132; 145..150; 155..170; 175..184; 191..212; 217..236; 240..250; 253..256; 259..263; 267..279; 287..294; 306..317; 331..346; 347..349; 358..369; 374..384; 420..437; 448..454; 464..467; 477..486
Beta Strand
137..140; 320..323; 490..492
3D Structure
NMR spectroscopy (1); X-ray crystallography (1)
Domain & Motif Annotations
Zinc Finger
498..548; Phorbol-ester/DAG-type
Domain (CC)
The N-terminal Ras-GEF domain mediates association with F-actin.
Domain (FT)
4..126; N-terminal Ras-GEF; 154..387; Ras-GEF; 426..461; EF-hand 1; 455..490; EF-hand 2
Region
382..406; Disordered; 557..592; Disordered
Protein Families
RASGRP family
Sequence Similarities
Belongs to the RASGRP family.
Supporting Publications3
| PMID | Title | Related sentences |
|---|---|---|
| 23161513 | Proteomic analysis of exosomes from mutant KRAS colon cancer cells identifies intercellular transfer of mutant KRAS. | Exosomes from mutant KRAS cells contain many tumor-promoting proteins, including KRAS, EGFR, SRC family kinases, and integrins. |
| 28369848 | End stage renal disease-induced hypercalcemia may promote aortic valve calcification via Annexin VI enrichment of valve interstitial cell derived-matrix vesicles. | No related sentences available |
| 28396511 | Database-augmented Mass Spectrometry Analysis of Exosomes Identifies Claudin 3 as a Putative Prostate Cancer Biomarker. | No related sentences available |