Protein detail
S29A4
Equilibrative nucleoside transporter 4 (hENT4) (Plasma membrane monoamine transporter) (PMAT) (Solute carrier family 29 member 4)
Entry name S29A4 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 10 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Equilibrative nucleoside transporter 4 (hENT4) (Plasma membrane monoamine transporter) (PMAT) (Solute carrier family 29 member 4)
Protein Function
Transporters:Electrochemical Potential-driven transporters
Transmembrane
69..89; Helical; 102..122; Helical; 140..160; Helical; 167..187; Helical; 232..252; Helical; 352..372; Helical; 382..402; Helical; 417..437; Helical; 451..471; Helical; 487..509; Helical
Transmembrane Count
10
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization1
Cell SpecificEsophageal apical cells
Function & Pathway6
Protein Function
Transporters:Electrochemical Potential-driven transporters
Cellular Component (4)
Molecular Function (9)
- GO:0005326 neurotransmitter transmembrane transporter activity
- GO:0005337 nucleoside transmembrane transporter activity
- GO:0005342 organic acid transmembrane transporter activity
- GO:0008324 monoatomic cation transmembrane transporter activity
- GO:0008504 monoamine transmembrane transporter activity
- GO:0015101 organic cation transmembrane transporter activity
- GO:0015562 efflux transmembrane transporter activity
- GO:0019534 toxin transmembrane transporter activity
- GO:0042910 xenobiotic transmembrane transporter activity
Biological Process (3)
Reactome (4)
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence31
Ligand-Receptor Signaling (30)
30 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | No | Yes | No |
| transporter | transporter | Surfaceome | No | Yes | No | Yes | No |
| solute_carrier | transporter | Almen2009 | No | Yes | No | Yes | No |
| mfs | transporter | Surfaceome | No | Yes | No | Yes | No |
| slc29 | transporter | Surfaceome | No | Yes | No | Yes | No |
| slc | transporter | Surfaceome | No | Yes | No | Yes | No |
Page 1 of 3Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry | 16 | 40985879321069903811336837322475388959624106825338891077375638573256072331617158408407013223097038207106390017003698231239207047 |
Sequence, Structure & Domains9
Sequences
Length
530
Mass
58,059
Sequence
MGSVGSQRLEEPSVAGTPDPGVVMSFTFDSHQLEEAAEAAQGQGLRARGVPAFTDTTLDEPVPDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVLVERLTLHTRITAGYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFLVSVALELLCFLLHLLVRRSRFVLFYTTRPRDSHRGRPGLGRGYGYRVHHDVVAGDVHFEHPAPALAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVARVIWADMLSIAVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLACSCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTVSYMSGLTLGSAVAYCTYSLTRDAHGSCLHASTANGSILAGL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q7RTT9-1; Sequence=Displayed; Name=2; IsoId=Q7RTT9-2; Sequence=VSP_032647
Alternative Sequence
139..182; GYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGCTV -> ASATCGCSSSLGTRPTPSTWPLWAPWPSAA (in isoform 2)
Domain & Motif Annotations
Domain (CC)
Glu-206 is essential for cation selectivity and may function as the charge sensor for cationic substrates.
Region
1..21; Disordered
Protein Families
SLC29A/ENT transporter (TC 2.A.57) family
Sequence Similarities
Belongs to the SLC29A/ENT transporter (TC 2.A.57) family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 39408670 | Proteomic Characterization of Corneal Epithelial and Stromal Cell-Derived Extracellular Vesicles. | No abstract available |