Protein detail
S36A1
Proton-coupled amino acid transporter 1 (Proton/amino acid transporter 1) (hPAT1) (Solute carrier family 36 member 1)
Protein symbol S36A1 | UniProt ID | EVMP score 0.38 |
Frequency | Transmembrane count 11 | Protein classification Metabolic proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Proton-coupled amino acid transporter 1 (Proton/amino acid transporter 1) (hPAT1) (Solute carrier family 36 member 1)
Protein Class
Metabolic proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Transporters:Electrochemical Potential-driven transporters
- Predicted intracellular proteins
Transmembrane
52..72; Helical; Name=1; 79..99; Helical; Name=2; 142..162; Helical; Name=3; 191..211; Helical; Name=4; 216..236; Helical; Name=5; 258..278; Helical; Name=6; 290..310; Helical; Name=7; 343..363; Helical; Name=8; 373..393; Helical; Name=9; 398..418; Helical; Name=10; 440..460; Helical; Name=11
Transmembrane Count
11
Ensembl
Entrez Gene Symbol
Gene Synonym
LYAAT-1PAT1TRAMD3
Gene Description
Solute carrier family 36 member 1
Chromosome
5
Position
151437046-151492379
EVMP Score
0.38
Fluorescence & Localization
Tissue SpecificcervixCell SpecificEsophageal apical cellsSecretome LocationSecreted in other tissuesSecretome FunctionReceptor
Function & Pathway
Protein Function
- Transporters:Electrochemical Potential-driven transporters
- Predicted intracellular proteins
Cellular Component
Molecular Function
- GO:0005280 amino acid:proton symporter activity
- GO:0005297 proline:proton symporter activity
- GO:0005368 taurine transmembrane transporter activity
- GO:0005515 protein binding
- GO:0015171 amino acid transmembrane transporter activity
- GO:0015180 L-alanine transmembrane transporter activity
- GO:0015187 glycine transmembrane transporter activity
- GO:0015193 L-proline transmembrane transporter activity
- GO:0022858 alanine transmembrane transporter activity
Biological Process
Reactome
Canonical Pathways
- M235 Pid tcr calcium pathway
- M290 Pid il12 stat4 pathway
- M113 Pid nfat 3pathway
Mediation Categories
Fusion and delivery mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
26 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| slc | transporter | Surfaceome | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyMicrofluidics-Based Methods | Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 7 | 32938681317537264116790429603567246701523086538136028467 |
Sequence, Structure & Domains
Sequences
Length
476
Mass
53,076
Sequence
MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGNIGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTVMYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q7Z2H8-1; Sequence=Displayed; Name=2; IsoId=Q7Z2H8-3; Sequence=VSP_044392; Name=3; IsoId=Q7Z2H8-4; Sequence=VSP_044390, VSP_044391
Alternative Sequence
242..243; RI -> IL (in isoform 3); 244..476; Missing (in isoform 3); 387..476; Missing (in isoform 2)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
1..15; Basic and acidic residues
Region
1..32; Disordered
Protein Families
Amino acid/polyamine transporter 2 family
Sequence Similarities
Belongs to the amino acid/polyamine transporter 2 family.
Clinical Relevance
Antibody