Protein detail
GRIN1
G protein-regulated inducer of neurite outgrowth 1 (GRIN1)
Entry name GRIN1 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 8 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
G protein-regulated inducer of neurite outgrowth 1 (GRIN1)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
GRIN1KIAA1893
Gene Description
G protein regulated inducer of neurite outgrowth 1
Chromosome
5
Position
176595802-176610156
Supporting publications (n)
8
EVMP confidence score
0.63
Fluorescence & Localization2
Tissue SpecifictestisCell SpecificEarly spermatids
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Reactome (3)
Mediation Categories
Other mediation
Relations & Evidence6
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MECP2 | P51608 | GRIN1 | Q7Z2K8 | Yes | Yes | No | SIGNOR | SIGNOR:18511691 |
Sequence, Structure & Domains7
Sequences
Length
1,008
Mass
102,399
Sequence
MDTAEDPAWLQLLQKDSSPPGPRPTAFFCPQDGSLGAGSSAMRDYCPSQQKASPAPPRHTPDQSPGMESRHRSPSGAGEGASCSDGPRGSLACPSPTCFSPQESPSKETLEAHGASISGTPEATTSGKPEPVSSVKTEPKSSDDRNPMFLEKMDFKSSKQADSTSIGKEDPGSSRKADPMFTGKAEPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPTSAEKVDLVLSGKRDPGPSGKADPMPLESMDSASTGKTEPGLLGKLIPGSSGKNGPVSSGTGAPGSLGRLDPTCLGMADPASVGNVETVPATKEDSRFLGKMDPASSGEGRPVSGHTDTTASAKTDLTSLKNVDPMSSGKVDPVSLGKMDPMCSGKPELLSPGQAERVSVGKAGTVSPGKEDPVSSRREDPISAGSRKTSSEKVNPESSGKTNPVSSGPGDPRSLGTAGPPSAVKAEPATGGKGDPLSSEKAGLVASGKAAPTASGKAEPLAVGKEDPVSKGKADAGPSGQGDSVSIGKVVSTPGKTVPVPSGKVDPVSLGKAEAIPEGKVGSLPLEKGSPVTTTKADPRASGKAQPQSGGKAETKLPGQEGAAAPGEAGAVCLKKETPQASEKVDPGSCRKAEPLASGKGEPVSLGKADSAPSRKTESPSLGKVVPLSLEKTKPSSSSRQLDRKALGSARSPEGARGSEGRVEPKAEPVSSTEASSLGQKDLEAAGAERSPCPEAAAPPPGPRTRDNFTKAPSWEASAPPPPREDAGTQAGAQACVSVAVSPMSPQDGAGGSAFSFQAAPRAPSPPSRRDAGLQVSLGAAETRSVATGPMTPQAAAPPAFPEVRVRPGSALAAAVAPPEPAEPVRDVSWDEKGMTWEVYGAAMEVEVLGMAIQKHLERQIEEHGRQGAPAPPPAARAGPGRSGSVRTAPPDGAAKRPPGLFRALLQSVRRPRCCSRAGPTAE
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q7Z2K8-1; Sequence=Displayed; Name=2; IsoId=Q7Z2K8-2; Sequence=VSP_018546, VSP_018547
Alternative Sequence
748..798; VEPKAEPVSSTEASSLGQKDLEAAGAERSPCPEAAAPPPGPRTRDNFTKAP -> QASARPVPRAAAECAPAAVLLAGGTHGRVICPHFVRPSFRPSQAPFLITGP (in isoform 2); 799..1008; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
117..127; Polar residues; 137..159; Basic and acidic residues; 167..178; Basic and acidic residues; 230..269; Basic and acidic residues; 279..291; Basic and acidic residues; 326..336; Polar residues; 391..406; Polar residues; 454..466; Basic and acidic residues; 481..491; Polar residues; 549..559; Basic and acidic residues; 643..656; Low complexity; 659..679; Basic and acidic residues; 742..752; Basic and acidic residues; 755..764; Polar residues; 838..847; Low complexity
Region
1..859; Disordered; 899..1008; Interaction with GNAO1; 943..986; Disordered
Supporting Publications7
| PMID | Title | Abstract |
|---|---|---|
| 30640524 | Trafficking of a multifunctional protein by endosomal microautophagy: linking two independent unconventional secretory pathways. | GAPDH recruited to this common entry point is subsequently delivered into multivesicular bodies, leading to its membrane trafficking through secretion via exosomes and secretory lysosomes. |
| 33497388 | The characterization of exosomes from fibrosarcoma cell and the useful usage of Dynamic Light Scattering (DLS) for their evaluation. | Results from dot blot and western blot analysis demonstrated that GM1 ganglioside, and TSG101, HSC70 and GAPDH proteins were contained in exosomes from the WEHI-164 fibrosarcoma cell line. The existence of tetraspanins such as CD81, CD63 and CD9 was confirmed in the exosomes by ExoView analysis. |
| 33501690 | Validation of common reference genes stability in exosomal mRNA-isolated from liver and breast cancer cell lines. | Here, we analyzed the expression and stability of eight well-known reference genes namely GAPDH, B2M, HPRT1, ACTB, YWHAZ, UBC, RNA18S, and TBP in exosomes-isolated from the liver (Huh7, HepG2, PLC/PRF/5) and breast (SK-BR-3) cancer cell lines using five different algorithms including geNorm, BestKeeper, Delta Ct, NormFinder, and RefFinder. Our results showed that ACTB, TBP, and HPRT1 were not expressed in exosomes-isolated from studied liver and breast cancer cell lines. |
| 34080172 | Proteomic Alterations in Salivary Exosomes Derived from Human Papillomavirus-Driven Oropharyngeal Cancer. | Importantly, we demonstrate elevated protein levels of six main glycolytic enzymes [i.e., aldolase (ALDOA), glyceraldehye-3-phosphate dehydrogenase (GAPDH), lactate dehydrogenase A/B (LDHA and LDHB), phosphoglycerate kinase 1 (PGK1) and pyruvate kinase M1/2 (PKM)] in isolated salivary exosomes of HPV-driven OPC patients, suggesting a novel mechanism underlying the potential role of salivary exosomes in mediating the reciprocal interplay between glucose metabolism and HPV-driven OPC. |
| 34507095 | Multiplexed analysis of small extracellular vesicle-derived mRNAs by droplet digital PCR and machine learning improves breast cancer diagnosis. | Here, we report a 4-plex droplet digital PCR technology for simultaneous detection of four small extracellular vesicle (sEV)-derived mRNAs (PGR, ESR1, ERBB2 and GAPDH) in combination with machine learning (ML) algorithms to improve breast cancer diagnosis. |
| 35182987 | Inhibition of gene expression and production of iNOS and TNF-α in experimental model of neurodegenerative disorders stimulated microglia by Soy nano-isoflavone/stem cell-exosomes. | No abstract available |
| 36187097 | Differential expression of aerobic oxidative metabolism-related proteins in diabetic urinary exosomes. | In diabetic patients, aerobic oxidative metabolism is reduced, and the expression of aerobic oxidative metabolism-related proteins PFKM, GAPDH, ACO2, and MDH2 in urinary exosomes is reduced, which may become potential biomarkers for monitoring changes in diabetes. PFKM, GAPDH, ACO2, and MDH2 in urinary exosomes have certain monitoring value. The concentrations of PFKM, GAPDH and ACO2 in urinary exosomes were linearly correlated with the expression of MDH2 (P<0.05). |